DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and mfsd14b

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001011334.1 Gene:mfsd14b XenbaseID:XB-GENE-5783273 Length:493 Species:Xenopus tropicalis

Alignment Length:485 Identity:95/486 (20%)
Similarity:164/486 (34%) Gaps:150/486 (31%)


  Fly   170 PIIGEAL-------SFTCQIISSIFFESLP---MEFGAYCEAIVPALFGGLTFCLMAIYSYITIA 224
            |:|| ||       ||   ::.::||...|   ::...:....|.::.|........|::|:...
 Frog    90 PLIG-ALSDVWGRKSF---LLLTVFFTCAPIPLLKISPWWYFAVISMSGVFAVTFSVIFAYVADI 150

  Fly   225 TPEEDRVFRFGI----FAMFVTGVPFIGQPISGVLFTTLGYTWSFASAIVFQLIAIFYIIFFIKE 285
            |.|.:|...:|:    ||..:...|.||..:|.....||...  .||.:.  |:.|.:|:..:  
 Frog   151 TQEHERSTAYGLVSATFAASLVTSPAIGAYLSRAYGDTLVVV--LASGVA--LLDIGFILLAV-- 209

  Fly   286 VKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNFQLTPQMEPKVEVVPPK 350
                         |..||..:.|...||. :::|..:                          |.
 Frog   210 -------------PESLPEEMRPVSWGAP-ISWEQAD--------------------------PF 234

  Fly   351 RSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGPTSGENDYWYRFTLKKLAWNG 415
            .||.|...|.|::|.||                    ..||:..|.:|:.               
 Frog   235 ASLRKVGQDSTVLLICI--------------------TVFLSYLPEAGQY--------------- 264

  Fly   416 NDFSIYLTLSSG--AALVGTFIG-TAILSKL-----LKVSDSMIGMLSALSI-----VCSRVLFA 467
            :.|.:||....|  :..|..||| ..|||.|     |.:....||..:.:.:     :.....:.
 Frog   265 SSFFLYLRQVIGFTSETVAAFIGVVGILSILAQTVVLGIFMRSIGNKNTILLGLGFQILQLAWYG 329

  Fly   468 FSSSTASFYVAGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIF--------GISEPIAQFIFP 524
            |.|.....:.||.|....|:...||..:.|.....|:...:..:.        |:...:..|:|.
 Frog   330 FGSQQWMMWAAGAVAAMSSITFPAISAVVSRNADPDQQGVVQGMVTGIRGLCNGLGPALYGFVFY 394

  Fly   525 PIFSEIYK-STVDS------------------FPGAIWLFGEIFYIPNVLV--FVVCYFLLRRRK 568
            ....|:.: :.|::                  .||..:|||....:.::||  |:..:..|..|.
 Frog   395 LFHVELNEMADVETGSKSLKPNMANPSDERSIIPGPPFLFGACSVLLSLLVALFIPEHTSLTLRS 459

  Fly   569 ANEEKSVVEMEQNGGANGGNRASVVPDSEI 598
            ...:|.         :||....:::|.:.:
 Frog   460 GVHKKH---------SNGAQSHALLPPAHL 480

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 28/115 (24%)
MFS_1 143..>271 CDD:284993 28/115 (24%)
MFS <379..559 CDD:119392 42/222 (19%)
mfsd14bNP_001011334.1 MFS 40..393 CDD:119392 78/388 (20%)
MFS_1 42..386 CDD:284993 77/381 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.