DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and CG15553

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_651841.3 Gene:CG15553 FlyBaseID:FBgn0039817 Length:521 Species:Drosophila melanogaster

Alignment Length:563 Identity:143/564 (25%)
Similarity:244/564 (43%) Gaps:97/564 (17%)


  Fly    31 W-RYRHYLVIEPFFFFYFMASVFNAVAMQNFPLDKACRVNLGYNKIVCDTMLDKSELGIECDDFD 94
            | |..:...|||..|....:.:.:...|:|..:.:||.|...||:             .:|...|
  Fly    14 WGRLFNMFYIEPVLFMLIFSHMLSGTVMRNQLIYQACTVIFQYNE-------------TDCKLLD 65

  Fly    95 FENTTQGATPDLADLVIGATGFNYTVCKA-ELEAQILAADVSGKRAPMAAIFPLIVLLFAGGWAD 158
            .:|||                   |..:| |.|.|...|::...|....:|.|.|..||.|.|:|
  Fly    66 SKNTT-------------------TEIQAIETELQDYVANMFLTRTLFESIMPAICGLFVGSWSD 111

  Fly   159 RYNKRKPCMIMPIIGEALSFTCQIISSI------FFESLPMEFGAYCEAIVP-ALFGGLTFCLMA 216
            :|. |||.||:.::|.:.|   .:||||      ::...|.   .|..|.|| ::.||.....:|
  Fly   112 QYG-RKPLMIVSLVGFSAS---ALISSIICWLSSYYMVNPW---WYTLAAVPHSVLGGWCVFSVA 169

  Fly   217 IYSYITIATPEEDRVFRFGIFAMFVTGVPFI----GQPISGVLF--TTLGYTWSFASAIVFQLIA 275
            .:.:||..|..:.|.:|.    :|:..:.|:    |..:|..::  |:..:..|.:..||  :||
  Fly   170 AFCFITDTTDMKTRPYRM----IFMEIILFVALTSGSLLSSFVYAATSSAFVQSLSCLIV--IIA 228

  Fly   276 IFYIIFFIKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNFQLTPQM 340
            ..:|||::.|          :....|....:|.|::..     ..|.||    :||...:::.:.
  Fly   229 TLFIIFYLPE----------SLGMSPEEDEIPEKEKNV-----VVTVLD----HKNKTNEISAEA 274

  Fly   341 E--------PKVEVVPPKRSLLKE-----LFDPTLVLDCIRFPLVKRPNNGRMLLILLLCAYFLT 392
            |        ||.|  .|::.|..:     ||....|.|.......||.||...::.|:..|.|::
  Fly   275 EKTENCDDPPKYE--SPEKPLEDKVEKAGLFSIKHVKDMFSTCFKKRENNAHTIIWLVTLAGFVS 337

  Fly   393 VGPTSGENDYWYRFTLKKLAWNGNDFSIYLTLSSGAALVGTFIGTAILSKLLKVSDSMIGMLSAL 457
            :....|.....|.|..::..:...||:|:.|.|....::|..:|..||.|...:|...:.:||.|
  Fly   338 IFVADGVMTVNYLFVRQQFHFTVRDFTIFETFSQSVPMLGAVLGILILRKFFGLSVVALALLSLL 402

  Fly   458 SIVCSRVLFAFSSSTASFYVAGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIFGISEPIAQFI 522
            |.|.:.:...|:..:...|::.|:.:|.|::....:||.|:||...:..|:::|..|.:..|.|:
  Fly   403 SEVAANIARGFAYLSWHLYLSVVLGIFRSIQGPMFRTIVSNIVPPSDTGKLFAIGNILQSFAPFV 467

  Fly   523 FPPIFSEIYKSTVDSFPGAIWLFGEIFYIPNVLVFVVCYFLLR 565
            ..|:::.|||.::.|.||........||   .|.|::..:::|
  Fly   468 AAPLYTAIYKESLASNPGGFNFLSAAFY---GLAFILIGWVMR 507

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 41/143 (29%)
MFS_1 143..>271 CDD:284993 41/141 (29%)
MFS <379..559 CDD:119392 48/180 (27%)
CG15553NP_651841.3 MFS_1 96..469 CDD:284993 106/407 (26%)
MFS 97..239 CDD:304372 47/165 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C9574532
eggNOG 1 0.900 E1_KOG2816
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I1638
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333052at33208
OrthoFinder 1 1.000 FOG0000485
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23507
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.