| Sequence 1: | NP_731899.1 | Gene: | CG31321 / 318681 | FlyBaseID: | FBgn0051321 | Length: | 601 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_649238.3 | Gene: | CG5078 / 40276 | FlyBaseID: | FBgn0037005 | Length: | 447 | Species: | Drosophila melanogaster | 
| Alignment Length: | 436 | Identity: | 95/436 - (21%) | 
|---|---|---|---|
| Similarity: | 157/436 - (36%) | Gaps: | 116/436 - (26%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly   223 IATPEE---DRVFRFGIFAMFVTGV-PFIGQPISG---------------VLFT-------TLGY 261 
  Fly   262 TWSFASAIVFQLIAIFYIIFF--IKEVKT----------TPTTSTTANEPPPLPTSLPPKQQGAD 314 
  Fly   315 NMAYETTNLDELQGNKNVNFQLTPQMEPKVEVVPPKRSLLKELFDPTLVLDCIRFPLVKRPNNGR 379 
  Fly   380 MLLILLLCAYFLT-VGPTSGEND---YWYRFTLKKLAWNGNDFSIYLTLSSGAALVGTFIGTAI- 439 
  Fly   440 -LSKLLKVSDSMIGMLSALSIVCSRVLFAFSSSTASFYVAG-----------VVDMFVSLRVIAI 492 
  Fly   493 KTIGS--SIVAGDELSKMYSIFGISEPIAQFIFPPIFSEIYKSTVDSFPGAIWLFGEI------- 548 
  Fly   549 --FYIPNVLVFVVCYFLL------------RRRKANEEKSVVEMEQ 580 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG31321 | NP_731899.1 | MFS | 141..>271 | CDD:119392 | 18/73 (25%) | 
| MFS_1 | 143..>271 | CDD:284993 | 18/73 (25%) | ||
| MFS | <379..559 | CDD:119392 | 47/207 (23%) | ||
| CG5078 | NP_649238.3 | MFS | 27..375 | CDD:119392 | 76/360 (21%) | 
| MFS_1 | 27..368 | CDD:284993 | 75/353 (21%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG2816 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||