| Sequence 1: | NP_731899.1 | Gene: | CG31321 / 318681 | FlyBaseID: | FBgn0051321 | Length: | 601 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_649237.1 | Gene: | CG17637 / 40275 | FlyBaseID: | FBgn0037004 | Length: | 504 | Species: | Drosophila melanogaster | 
| Alignment Length: | 502 | Identity: | 90/502 - (17%) | 
|---|---|---|---|
| Similarity: | 173/502 - (34%) | Gaps: | 114/502 - (22%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly   128 QILAAD--VSGKRAPMAAIFPLIVLLFAGGWADRYNKRKPCMIMPIIGEALSFTCQIISSIFFES 190 
  Fly   191 LPMEFGAYCEAIVPALFGGLTFCLMAIYSYITIATPEEDRVFRFG-IFAMFVTGVPFIGQPISGV 254 
  Fly   255 LFTTLGYTWSFASAIVFQLIAIFYIIFFIKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYE 319 
  Fly   320 TTNLDE---------LQGNKNVNFQLTPQMEPKVEVVPPKRSL---------------LKELFDP 360 
  Fly   361 TLVLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGPTSGENDYWYRFTLKKLAWNGNDFSIYLTLS 425 
  Fly   426 SGAALVGTFIGTAILSKLLKVSDSMIG------------MLSALSIVCSRVLFAFSSSTASFYVA 478 
  Fly   479 GVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIFGISEPIAQFIFPPIFSEIY-----KSTVD-- 536 
  Fly   537 -----SFPGAIWLFGEIFYIPNVLVF---VVCYFLLRRRKANEEKSV 575 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG31321 | NP_731899.1 | MFS | 141..>271 | CDD:119392 | 23/130 (18%) | 
| MFS_1 | 143..>271 | CDD:284993 | 23/128 (18%) | ||
| MFS | <379..559 | CDD:119392 | 34/206 (17%) | ||
| CG17637 | NP_649237.1 | MFS | 25..487 | CDD:119392 | 86/489 (18%) | 
| MFS_1 | 30..441 | CDD:284993 | 74/434 (17%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG2816 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||