DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31321 and CG17637

DIOPT Version :9

Sequence 1:NP_731899.1 Gene:CG31321 / 318681 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_649237.1 Gene:CG17637 / 40275 FlyBaseID:FBgn0037004 Length:504 Species:Drosophila melanogaster


Alignment Length:502 Identity:90/502 - (17%)
Similarity:173/502 - (34%) Gaps:114/502 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 QILAAD--VSGKRAPMAAIFPLIVLLFAGGWADRYNKRKPCMIMPIIGEALSFTCQIISSIFFES 190
            ::|..|  |.|.|    .|...:.....|..:| ::.||..|::.:..........::.|.:|.:
  Fly    57 RVLLVDGLVYGVR----GILGFVTTPVMGAISD-FHGRKVVMLLAVATTYAPIPFMMLKSWWFFA 116

  Fly   191 LPMEFGAYCEAIVPALFGGLTFCLMAIYSYITIATPEEDRVFRFG-IFAMFVTGVPFIGQPISGV 254
            : :...:.|         |.|:  .:..:|:...|..|:|...:| :.|.|..|:.| ...:...
  Fly   117 I-LTVSSIC---------GSTY--SSSLAYVADTTTVENRSKGYGFVAASFGAGIAF-SPSLGNY 168

  Fly   255 LFTTLGYTWSFASAIVFQLIAIFYIIFFIKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYE 319
            |..:.|.......|.:..:|.|.:|||.:.|...........||             ..||.. |
  Fly   169 LMKSYGSASVILIATITGMINILFIIFAVPESLVLKEKKVILNE-------------NNDNKV-E 219

  Fly   320 TTNLDE---------LQGNKNVNFQLTPQMEPKVEVVPPKRSL---------------LKELFDP 360
            .|.:|:         |.|...||.::.   :|..:.:...:.|               .||..|.
  Fly   220 DTKVDDISPKEKKENLNGEGKVNVEVN---KPTSQNIVTNKELDQQFSKEENLQNDLTEKEKIDN 281

  Fly   361 TLVLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGPTSGENDYWYRFTLKKLAWNGNDFSIYLTLS 425
            ..:.....:.::::....:.||::.|.. ||::.|.:|.:               :...:||..:
  Fly   282 GSLNSSDLWEVLRKSRKDKNLLVIYLIT-FLSIWPFAGVD---------------STAPVYLKTN 330

  Fly   426 SGAALVGTFIGTAILSKLLKVSDSMIG------------MLSALSIVCSRVLFAFSSSTASFYVA 478
            .|.......:...:||.|...|:.::|            .|..|.:....:.|.|.:....::::
  Fly   331 MGFEYEEVSMMLGLLSVLAITSNILLGYIMNIVGAKWSIRLGLLLLFLQMLFFGFGTHHWMYWLS 395

  Fly   479 GVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIFGISEPIAQFIFPPIFSEIY-----KSTVD-- 536
            .::....::...|...:.|...:.|....:..|....|.:::.:.|..|..::     .|..|  
  Fly   396 SILAALATIIPAANNAVASIYASPDNRGAVLGIISGIECLSEGVGPAFFGLLFFIFQDDSETDLK 460

  Fly   537 -----SFPGAIWLFGEIFYIPNVLVF---VVCYFLLRRRKANEEKSV 575
                 |.|         |.|..:.||   |:..|:.:....|||..|
  Fly   461 VNSPISMP---------FVISAISVFVAIVLSSFIKKDTLGNEETRV 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 23/130 (18%)
MFS_1 143..>271 CDD:284993 23/128 (18%)
MFS <379..559 CDD:119392 34/206 (17%)
CG17637NP_649237.1 MFS 25..487 CDD:119392 86/489 (18%)
MFS_1 30..441 CDD:284993 74/434 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.