DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31321 and srp54

DIOPT Version :9

Sequence 1:NP_731899.1 Gene:CG31321 / 318681 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_988977.1 Gene:srp54 / 394574 XenbaseID:XB-GENE-960992 Length:504 Species:Xenopus tropicalis


Alignment Length:131 Identity:35/131 - (26%)
Similarity:60/131 - (45%) Gaps:36/131 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   435 IGTAILSKLLKVSDSMI---GMLSA-LSIVCSRVLFAFSSSTASFYVAGVVDMFVSLRVIAIKTI 495
            :|..|.|.|..:|::.|   .:|:| |..||..:|.|              |:.:.|    :|.:
 Frog     6 LGRKITSALRSLSNATIINEEVLNAMLKEVCKALLEA--------------DVNIKL----VKQL 52

  Fly   496 GSSIVAGDELSKMYSIFGISEPIAQFIFPPIFSEIYKSTVDSFPGA-IW--LFGEIFYIPNVLVF 557
            ..::.:..:|.:|.|  |:::  .:.|...:|.|:.| .||  ||. .|  ..|:    |||::|
 Frog    53 RENVKSAIDLEEMAS--GLNK--RKMIQHAVFKELVK-LVD--PGVKAWTPTKGK----PNVIMF 106

  Fly   558 V 558
            |
 Frog   107 V 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392
MFS_1 143..>271 CDD:284993
MFS <379..559 CDD:119392 35/131 (27%)
srp54NP_988977.1 SRP54_euk 2..430 CDD:273615 35/131 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I7096
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.