DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and CG8046

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_724761.1 Gene:CG8046 FlyBaseID:FBgn0033388 Length:519 Species:Drosophila melanogaster

Alignment Length:608 Identity:133/609 (22%)
Similarity:235/609 (39%) Gaps:163/609 (27%)


  Fly     1 MAKPRSSADA--------------AGNGSGAVDAE----PKLNYFQKLWRYRHYLVIEPFFFFYF 47
            :||.:.|.||              :|..:.||..|    |:.:..|.|..|    ::|||.....
  Fly    12 VAKAQRSGDADPEVASTASEKQRSSGASAIAVGTEFPGNPQASRPQSLGMY----LLEPFILILL 72

  Fly    48 MASVFNAVAMQNFPLDKACRVNLGYNKIVCDTMLDKSELGIECDDFDFENTTQGATPDLADLVIG 112
            .|..|::..::|..:.::|....||...||..:..|          :..|.|:            
  Fly    73 FAYNFSSTVLKNEVIYQSCTAGFGYPDSVCQLLGTK----------NITNETK------------ 115

  Fly   113 ATGFNYTVCKAELEAQILAADVSGKRAPMAAIFPLIVLLFAGGWADRYNKRKPCMIMPIIGEALS 177
                     :.|.:.|..||.|:.....:....|....||||.|||.|. |||.::...:|..|.
  Fly   116 ---------RIEEQVQPYAAQVTLAMRLVECFIPAFCGLFAGSWADHYG-RKPLLMCSFLGYGLQ 170

  Fly   178 FTCQIISSIFFESLPMEFGAYCE--------------AIVP--ALFGGLTFCLMAIYSYITIATP 226
            :   :||:..         |||.              :|||  .|...:|:.:.|: .:|...:.
  Fly   171 Y---LISAAI---------AYCAMYTQGLVSPWWYVLSIVPLSCLGSSVTYSVAAV-CFIADVSG 222

  Fly   227 EEDRVFRFGIF--AMFVTGVPFIGQPISGVLFTTLGYTWSFASA---IVFQL--IAIFYIIFFIK 284
            .:.|.:|...:  |::|           |:|..:||..:::.:.   |||.:  :.||..:|.:.
  Fly   223 GKVRSYRMIAYELAIYV-----------GLLLGSLGSGYAYEATDAYIVFSISAVCIFTALFLMA 276

  Fly   285 EVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNFQLTPQMEPKVEVVPP 349
            .:               ||.|||.:                   |:.::   ||..:..|.    
  Fly   277 LL---------------LPESLPAR-------------------NRTLS---TPTTDTSVV---- 300

  Fly   350 KRSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGPTSGENDYWYRFTLKKLAWN 414
              |:||.|:.     .|.:    .|.:..|.:|..::....||...:.|.|..:|:|...|..|.
  Fly   301 --SMLKSLWS-----TCSK----PREHQNRFMLTTIMVVLLLTAFVSDGSNSVFYKFMRIKFHWT 354

  Fly   415 GNDFSIYLTLSSGAALVGTFIGTAILSKLLKVSDSMI---GMLSALSIVCSRVLFAFSSSTASFY 476
            ...|:.|.|:......|....|...:..|.|.::|.|   .::|.||...|.::..|:..:...|
  Fly   355 VKQFTEYETVGILVPAVAGSGGVLFIWSLRKCTNSAILWLALVSLLSHCSSSLMKGFALESWQIY 419

  Fly   477 VAGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIFGISEPIAQFIFPPIFSEIYKSTVDSFPGA 541
            ||..:.:|.||.....:|:.::::..||..|::::.|:.:.::..|...::..||..|:::.|| 
  Fly   420 VAIGLGVFKSLVNPMCRTMITNLLPADERGKIFALLGVLQALSPLISSTLYVAIYTRTLNTEPG- 483

  Fly   542 IWLFGEIFYIPNVLVFVVCYFLL 564
                  ||.:.:..:|.:...||
  Fly   484 ------IFNVFSAFLFGIGIILL 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 36/151 (24%)
MFS_1 143..>271 CDD:284993 36/149 (24%)
MFS <379..559 CDD:119392 44/183 (24%)
CG8046NP_724761.1 MFS_1 138..467 CDD:284993 91/406 (22%)
MFS 141..503 CDD:119392 100/445 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C9574555
eggNOG 1 0.900 E1_KOG2816
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I1638
Isobase 1 0.950 0 Normalized mean entropy S7720
OrthoDB 1 1.010 D333052at33208
OrthoFinder 1 1.000 FOG0000485
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23507
RoundUp 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.