DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and CG8008

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001137623.1 Gene:CG8008 FlyBaseID:FBgn0033387 Length:566 Species:Drosophila melanogaster

Alignment Length:586 Identity:143/587 (24%)
Similarity:247/587 (42%) Gaps:99/587 (17%)


  Fly    27 FQKLWRYRHYLVIEPFFFFYFMASVFNAVAMQNFPLDKACRVNLGYNKIVCDTMLDKSELGIECD 91
            ::|::|   ...|||..|....:...:....:|..:.:.|.|...||:             .:|.
  Fly    19 WEKVFR---MFYIEPVVFMLLFSHTLSGTIQRNQVIYQTCTVIFHYNE-------------SDCK 67

  Fly    92 DFDFENTTQGATPDLADLVIGATGFNYTVCKAELEAQILAADVSGKRAPMAAIFPLIVLLFAGGW 156
            ..|.:|         |...|.|         .|.|.|...|::...|..:.:|.|....||.|.|
  Fly    68 QLDVKN---------ASAEINA---------IETELQPYVANLFLARTLLESIVPAFCGLFIGSW 114

  Fly   157 ADRYNKRKPCMIMPIIGEALSF-----TCQIISSIFFESLPMEFGAYCEAIVP-ALFGGLTFCLM 215
            :|.|. |||.:|:.:||.:.||     .|::  |.::...|.   .|..|.|| :|.||.....:
  Fly   115 SDHYG-RKPLLIVSMIGFSASFLMMAAICEL--SSYYVVNPW---WYIMAAVPHSLLGGNCVFSV 173

  Fly   216 AIYSYITIATPEEDRVFRFGIFAMFVTGVPFIGQPISGVLFTTLGY-------TWSFASAIVFQL 273
            |.:.:|:..|..:.|.:|.    :|:..:.|||. .||.|.::..|       |...:..||  .
  Fly   174 AAFCFISDITDCKSRPYRM----IFMESLFFIGL-TSGSLLSSFVYAAVGSAATIGISGCIV--T 231

  Fly   274 IAIFYIIFFI-------KEVKTTPTTSTTAN-EPPPLPTSLP--PKQQGADNMAYE--TTNLDEL 326
            .|..:||||:       ||.:|  ..:.||| |...:.:.:|  ......|.:|.:  ...:::.
  Fly   232 FATLFIIFFVPESLHFHKEQET--KNAITANVEKECIDSKVPITACDLQLDRVAIDCPPNFMNDE 294

  Fly   327 QGNKNVNFQL----TPQME-------PKVEVVPPKRSLLKE-----------LFDPTLVLDCIRF 369
            :..|:...:|    ||.|.       ..||.:|.|....|.           ||....:.|.|..
  Fly   295 EPGKDKRMELPTPATPAMSFDDDLLAKYVERLPQKAEERKRQEAEEQAKKAGLFSMVHIRDMIST 359

  Fly   370 PLVKRPNNGRMLLILLLCAYFLTVGPTSGENDYWYRFTLKKLAWNGNDFSIYLTLSSGAALVGTF 434
            ...:|.::.|.::.|:..|.||::....|.....|.|..:|..|...|::.:.|:|....::|..
  Fly   360 CFKRRDHHARAIIWLVTLAMFLSIFVFDGVMTVMYLFVREKFHWTVRDYTFFETVSHLVPMIGAL 424

  Fly   435 IGTAILSKLLKVSDSMIGMLSALSIVCSRVLFAFSSSTASFYVAGVVDMFVSLRVIAIKTIGSSI 499
            ||..||.|:.::|...:.:|:..|.:.:.:...|::.....|::..:.:|.|:.....:||.|:|
  Fly   425 IGFLILRKVFRLSVVTLALLAFFSEILNNLAKGFATMPWHMYLSVTLGVFRSISGPMCRTIVSNI 489

  Fly   500 VAGDELSKMYSIFGISEPIAQFIFPPIFSEIYKSTVDSFPGAIWLFGEIFYIPNVLVFVVCYFLL 564
            |...:|.|::||..:.:..|.|:..|:::.|||.::.::||.........|:   |.||...::|
  Fly   490 VPPSDLGKIFSIKNVLQSFAPFVAAPLYTLIYKRSLTTYPGLFNFVSSFLYL---LSFVFIGYVL 551

  Fly   565 R 565
            |
  Fly   552 R 552

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 42/143 (29%)
MFS_1 143..>271 CDD:284993 42/141 (30%)
MFS <379..559 CDD:119392 47/180 (26%)
CG8008NP_001137623.1 MFS 101..547 CDD:119392 119/464 (26%)
MFS_1 101..>261 CDD:284993 53/175 (30%)
MFS_1 375..>558 CDD:284993 47/182 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C9574524
eggNOG 1 0.900 E1_KOG2816
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S7720
OrthoDB 1 1.010 D333052at33208
OrthoFinder 1 1.000 FOG0000485
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23507
RoundUp 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.