DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and CG15890

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001285245.1 Gene:CG15890 FlyBaseID:FBgn0030576 Length:599 Species:Drosophila melanogaster

Alignment Length:577 Identity:171/578 (30%)
Similarity:278/578 (48%) Gaps:95/578 (16%)


  Fly    15 SGAVDAEPKLNYFQKLWRYRHYLVIEPFFFFYFMASVFNAVAMQNFPLDKACRVNLGYNKIVCDT 79
            :|..:...|.::.:|:....:.:.:||....|.|.||.:.:|.||..|:||||||:.|...|||.
  Fly    48 NGTTNPPVKRSWREKIRLVANNVTVEPILAAYIMPSVLSNLATQNLNLEKACRVNMAYGDEVCDA 112

  Fly    80 MLDKSELGIECDDFDFENTTQGATPDLADLVIGATGFNYTVCKAELEAQILAADVSGKRAPMAAI 144
            :                  |:..|.            |||:  .|...|.:.|.::..:..:.::
  Fly   113 L------------------TRRQTA------------NYTL--EEETVQQMVARMAAWKTVIQSL 145

  Fly   145 FPLIVLLFAGGWADRYNKRKPCMIMPIIGEALSFTCQIISSIFFESLPMEFGAYCEAIVPALFGG 209
            ||.:::||.|.|:||:.:||||:::|::||.|. ...::..::||..|||..|..|||.|:|.||
  Fly   146 FPCLLILFWGSWSDRHRRRKPCILIPVVGEFLG-VVGLMLCVYFEQAPMEAAALTEAIFPSLSGG 209

  Fly   210 LTFCLMAIYSYITIATPEEDRVFRFGIF-AMFVTGVPFIGQPISGVLFTTLGYTWSFASAIVFQL 273
            ....||.::|||...|.||||..|.||. ..|..||| ||...||||...:|:...|:.:..|.:
  Fly   210 WFTMLMGVFSYIADITTEEDRTLRIGILNVCFSVGVP-IGMAFSGVLLKQIGFYGVFSISAAFYV 273

  Fly   274 IAIFYIIFFIKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNFQLTP 338
            ||..|..||::|                                                    |
  Fly   274 IAFVYGFFFLEE----------------------------------------------------P 286

  Fly   339 QMEPKVEVVPPKRSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGPTSGENDYW 403
            |..|  |....::|||.:.||...|:...|....|..|..|..:|||:....:.:||..||....
  Fly   287 QSRP--EKSAEQKSLLADFFDKEHVVQTFRVAFKKGENQRRKRVILLMIVVMVIIGPLHGEMAVT 349

  Fly   404 YRFTLKKLAWNGNDFSIYLTLSSGAALVGTFIGTAILSKLLKVSDSMIGMLSALSIVCSRVLFAF 468
            |.||..:..|:..:||.:.|.:....|:|......|||..|.:.|:::|:||:.|.:.|..::||
  Fly   350 YLFTRFRFNWSEVEFSFFSTYAMFTGLIGVIFCVGILSHKLNIDDALVGVLSSTSKILSSFVYAF 414

  Fly   469 SSSTASFYVAGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIFGISEPIAQFIFPPIFSEIYKS 533
            ::.....|:.|:|::|.....||:::|.:.:|:.|||.|:.|:||::|.:...:|.|:::.:|.:
  Fly   415 ATLPWHMYLGGLVEIFNGTAFIAMRSIATKLVSKDELGKVNSLFGVAEALMPMVFAPMYTTLYAA 479

  Fly   534 TVDSFPGAIWLFGEIFYIPNVLVFVVCY-FLLRRRK----ANEEKSVVEMEQNGGAN 585
            |:...|||.:|.|....:.:|.:|:..| |.:|:|:    |:.|.:.|: :.||..|
  Fly   480 TLRVLPGAFFLLGGGLTLFSVFIFLWMYRFQVRQRRNLASADAESAAVK-DPNGNIN 535

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 54/131 (41%)
MFS_1 143..>271 CDD:284993 54/129 (42%)
MFS <379..559 CDD:119392 56/180 (31%)
CG15890NP_001285245.1 MFS 135..507 CDD:119392 130/428 (30%)
MFS_1 135..470 CDD:284993 120/391 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C9574460
eggNOG 1 0.900 E1_KOG2816
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I1638
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333052at33208
OrthoFinder 1 1.000 FOG0000485
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23507
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.