DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and Mfsd14b

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001100804.1 Gene:Mfsd14b RGDID:1308377 Length:507 Species:Rattus norvegicus

Alignment Length:495 Identity:101/496 (20%)
Similarity:165/496 (33%) Gaps:162/496 (33%)


  Fly   170 PIIGEALS-------FTCQIISSIFFESLPME---------FGAYCEAIVPALFGGLTFCLMAIY 218
            |:|| |||       |   ::.::||...|:.         ||...   |..:| .:||.:  |:
  Rat   100 PLIG-ALSDVWGRKPF---LLGTVFFTCFPIPLMRISPWWYFGMIS---VSGVF-SVTFSV--IF 154

  Fly   219 SYITIATPEEDRVFRFG----IFAMFVTGVPFIGQPISGVLFTTLGYTWSFASAIVFQLIAIFYI 279
            :|:...|.|.:|...:|    .||..:...|.||..:|.      .|..|.. .:|..::|:..|
  Rat   155 AYVADFTQEHERSTAYGWVSATFAASLVSSPAIGTYLSS------NYGDSLV-VLVATVVALLDI 212

  Fly   280 IFFIKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNFQLTPQMEPKV 344
            .|.:..|            |..||..:.|...|| .::::..:                      
  Rat   213 CFILVAV------------PESLPEKIRPASWGA-QISWKQAD---------------------- 242

  Fly   345 EVVPPKRSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGPTSGENDYWYRFTLK 409
                |..||.|...|.|::|.||                    ..||:..|.:|:.         
  Rat   243 ----PFASLKKVGKDSTVLLICI--------------------TVFLSYLPEAGQY--------- 274

  Fly   410 KLAWNGNDFSIYL--TLSSGAALVGTFIG----------TAILSKLLKVSDSMIGMLSALSI-VC 461
                  :.|.:||  .:..|:..:..||.          |..||||::...:...:|..|.. :.
  Rat   275 ------SSFFLYLRQVIGFGSVKIVAFIAMVGILSILAQTVFLSKLMRSLGNKNTVLLGLGFQIL 333

  Fly   462 SRVLFAFSSSTASFYVAGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIF--------GISEPI 518
            ....:.|.:.....:.||.|....|:...|:..:.|.....|:......|.        |:...:
  Rat   334 QLAWYGFGAQAWMMWAAGTVAAMSSITFPAVSALISRNAESDQQGVAQGIITGIRGLCNGLGPAL 398

  Fly   519 AQFIFPPIFSEIYK--STVDS---------FPGAIWLFGEIFYIPNVLVFVVCYFLLRRRKANEE 572
            ..|||.....|:.:  ..:||         .||..:|||....:   :.|:|..|:...||....
  Rat   399 YGFIFYLFHVELNELGPKLDSDNDPLQGAFIPGPPFLFGACIVL---MSFLVALFIPEYRKTGGV 460

  Fly   573 KSVVEMEQNGGANG--------GNRASVVP---DSEITSL 601
            :     :.|...:|        |:...:.|   ||.|..|
  Rat   461 Q-----KHNNSISGSLSTPPERGSDEDIEPLLQDSNIWEL 495

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 31/121 (26%)
MFS_1 143..>271 CDD:284993 31/121 (26%)
MFS <379..559 CDD:119392 39/212 (18%)
Mfsd14bNP_001100804.1 MFS 50..452 CDD:119392 91/446 (20%)
MFS_1 51..396 CDD:284993 77/387 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D763423at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.