DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and Slc46a2

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001100122.1 Gene:Slc46a2 RGDID:1310485 Length:480 Species:Rattus norvegicus

Alignment Length:432 Identity:89/433 (21%)
Similarity:173/433 (40%) Gaps:65/433 (15%)


  Fly   141 MAAIFPLIVLLFAGGWADRYNKRKPCMIMPIIGEALSFTCQIISSIFFESLPMEFGAYCEAIVPA 205
            :..:.||:.....|..:|||: ||..:...::|..||....::..:....|.:.:||   |.:..
  Rat    86 VVGLTPLLSAYVLGWLSDRYH-RKISICTAMLGFLLSRIGLLLKVMLDWPLEVMYGA---AALNG 146

  Fly   206 LFGGLTFCLMAIYSYITIATPEEDRVFRFGIFAMFVTGVPFIGQPISGVLFTTL-GYTWS----F 265
            |.||.:.....:.:..:::..:..|..|..:..:.:....|.|...||.||..: |::..    .
  Rat   147 LCGGFSAYWSGVMALGSLSCSQSRRSVRLILIDLVLGLAGFCGSMASGHLFKQIVGHSAQGLLLT 211

  Fly   266 ASAIVFQLIAIFYIIFFIKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNM--AYETTNLDELQG 328
            |.::.....|:||.:|.:|           ..|....|..:.|.......|  .|.|.:.|:   
  Rat   212 ACSVGCAAFALFYSLFVLK-----------VPEAVSKPNKVHPTVDTVSGMMGTYRTLDPDQ--- 262

  Fly   329 NKNVNFQLTPQMEPKVEVVPPKRSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILL-LCAYFLT 392
                      |.:|.::..||.                   |..::|:...:.|:.: ...|.|.
  Rat   263 ----------QDKPNIQANPPT-------------------PGKEKPSQAIIALLFVGAIVYDLA 298

  Fly   393 VGPTSGENDYWYRFTLK-KLAWNGNDFSIYLTLSSGAAL-VGTFIGTAILSKLLKVSDSMIGMLS 455
            |   .|..|....|.|| .|.|  |...:...::||..: :.:|:|..:.|:..:  |:.:.::.
  Rat   299 V---VGTLDVMALFVLKDPLHW--NQVQLGYGMASGYIIFITSFLGVLVFSRYFR--DTTMIIIG 356

  Fly   456 ALSIVCSRVLFAFSSSTASFYVAGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIFGISEPIAQ 520
            .:|.....:|.||...|..||:|..|.:|..:.:..|::..|.:|......|::.|..:...:..
  Rat   357 MVSFGSGALLLAFVKKTYMFYIARAVMLFALIPITTIRSAMSKLVKDSSYGKIFVILQLCLALTG 421

  Fly   521 FIFPPIFSEIYKSTVDSFPGAIWLFGE-IFYIPNVLVFVVCY 561
            .:...::::||:.|::.|.|..:|... :.::..|.:.||.|
  Rat   422 VVTSTMYNKIYQLTLNKFAGTCFLLSSFLSFLAIVPIGVVAY 463

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 28/135 (21%)
MFS_1 143..>271 CDD:284993 28/133 (21%)
MFS <379..559 CDD:119392 41/184 (22%)
Slc46a2NP_001100122.1 MFS 86..433 CDD:119392 81/401 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C9582531
eggNOG 1 0.900 E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333052at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23507
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.