DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and Slc46a3

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001020139.1 Gene:Slc46a3 RGDID:1307594 Length:461 Species:Rattus norvegicus

Alignment Length:481 Identity:107/482 (22%)
Similarity:185/482 (38%) Gaps:117/482 (24%)


  Fly   122 KAELEAQILAADVSGKRAPMAAIFPLIVLLFAGGWADRYNKRKPCMIMPIIGEALSFTCQIISSI 186
            ||.|.:  |..::||....:.:.|.|:      ..:|.:.::.| |::..:| :|.....:.:..
  Rat    68 KASLFS--LQVEISGLIPGLVSTFMLL------SSSDNHGRKLP-MVLSSLG-SLGTNLWLCAMS 122

  Fly   187 FFESLPMEFGAYCEAIVPALFGGLTFCLMAIYSYITIATPE-EDRVFRFGIFAMF---VTGVPFI 247
            :|: ||::. ......:.||||..|....|.::||.....| :.|:.|..:....   |||:..:
  Rat   123 YFD-LPLQL-LVASTFIGALFGNYTTFWGACFAYIVDQEKEYKHRIIRIAVLDFMLGVVTGLTGL 185

  Fly   248 GQPISGVLFTTLGYTWSFASAIVFQLIAIFYIIFFIKEVKTTPTTSTTANEPPPLPTSLPPKQQG 312
            .   ||.....||:.||:....|..|:.:.||:||:.:                           
  Rat   186 S---SGYFIRELGFAWSYFIIAVVVLVNLAYILFFLSD--------------------------- 220

  Fly   313 ADNMAYETTNLDELQGNKNVNFQLTPQMEPKVEVVPPKRS-LLKELFDPTLVL----DCIRFPLV 372
                                     |..|...::|....| .||:||..|.:|    .|.|..|:
  Rat   221 -------------------------PIKESSSQIVTMSCSESLKDLFYRTYMLFKNGSCKRRSLL 260

  Fly   373 KRPNNGRMLLILLLCAYFLTV-GPTSGENDYWYRFTLKK----LAWNGNDFSIYLTLSSGAAL-- 430
                   .|||..|..||..| |.|.       .|||.:    |.||    .:|  :..|:||  
  Rat   261 -------CLLIFTLVVYFFVVFGITP-------VFTLYELGPPLCWN----EVY--IGYGSALGS 305

  Fly   431 ---VGTFIGTAILSKLLKVSDSMIGMLSALSIVCSRVLFAFSSSTASFYVAGVVDMFVSLRVIAI 492
               :.:|:|..:.|..||  |..|..:...:.:...:|.||:.:|...::..:...|..:.:..:
  Rat   306 LSFLSSFLGIWLFSYCLK--DIHIAYVGIFTTMVGMMLTAFTRTTLMMFLVRISFFFTIMPLSIL 368

  Fly   493 KTIGSSIVAGDELSKMYSIFGISEPIAQFIFPPIFSEIYKSTVDSFPGAIWLFGE-IFYIPNV-L 555
            :::.|.:|...|...:::.....|.:........::.||.:||..:||.::|... :..:|.| |
  Rat   369 RSMLSKVVHSTEQGVLFACIAFLETLGGVTSTSAYNGIYSATVAWYPGFVFLLSAGLLVLPAVSL 433

  Fly   556 VFVVC-------YFLLRRRKANEEKS 574
            ..|.|       |.||...:.:|..|
  Rat   434 CMVKCIGWEEGSYTLLIHDEPSEHTS 459

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 31/134 (23%)
MFS_1 143..>271 CDD:284993 31/132 (23%)
MFS <379..559 CDD:119392 46/192 (24%)
Slc46a3NP_001020139.1 MFS 95..437 CDD:119392 93/423 (22%)
MFS_1 95..397 CDD:284993 82/383 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C9582470
eggNOG 1 0.900 E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333052at33208
OrthoFinder 1 1.000 FOG0000485
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23507
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.