DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and CG30345

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_724760.2 Gene:CG30345 FlyBaseID:FBgn0050345 Length:496 Species:Drosophila melanogaster

Alignment Length:583 Identity:126/584 (22%)
Similarity:223/584 (38%) Gaps:130/584 (22%)


  Fly    18 VDAEPKLNYFQKLWRYR-HYLVIEPFFFFYFMASVFNAVAMQNFPLDKACRVNLGYNKIVCDTML 81
            |.:.|..|.....|..| ..|::||..|..|..........||..|.:.|...:.||        
  Fly    21 VRSPPPSNRTFSSWLKRPRSLILEPAVFLVFFGRFLTDAVYQNQILYQTCVTVMKYN-------- 77

  Fly    82 DKSELGIECDDFDFENTTQGATPDLADLVIGATGFNYTVCKAELEAQILAADVSGKRAPMAAIFP 146
                 ..||:.|                 :|....:..|.|.|.:.|..|:.::...:.:.:..|
  Fly    78 -----ATECEPF-----------------LGTDRASDEVKKIEGQVQEYASTITMISSMLESTVP 120

  Fly   147 LIVLLFAGGWADRYNKRKPCMIMPIIGEALSFTCQIISSIFFESLPMEFGAYCEAIVPALFGGLT 211
            .||.||.|.|:|::. |:|.::....|...|....::.:....::.:....:..:.||::|.|.|
  Fly   121 AIVSLFLGPWSDKFG-RRPILLSTFTGYLFSAIILVVLTQITTAVNISPWWFLLSSVPSVFSGGT 184

  Fly   212 FCLMAI-YSYITIATPEEDRVFR-------FGIFAMFVTGVPFIGQPISGVLFTTLGYTWSFASA 268
            ..|:.| |.|::....|..|..|       .|: .|...||      .||.::...|      ::
  Fly   185 CALITILYCYVSDVATENKRAMRMVTMEAALGL-GMMAGGV------ASGYIYAATG------AS 236

  Fly   269 IVFQL------IAIFYIIFFIKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQ 327
            |:|.|      ||:.|:.||:.|                   ||..:.....:...|...||   
  Fly   237 ILFILVGSIISIALLYVYFFVAE-------------------SLKSEDLETGSRIREFFRLD--- 279

  Fly   328 GNKNVNFQLTPQMEPKVEVVPPKRSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLCAYFLT 392
                                     |:|     .||..|||    ||.|..|.::..::.:..|.
  Fly   280 -------------------------LVK-----VLVKTCIR----KRENYDRAIIWFVMMSLTLC 310

  Fly   393 VGPTSGENDYWYRFTLKKLAWNGNDFSIYLTLSSGAALVGTFIGTAILSKLLKVSDSMIGMLSAL 457
            |....||:...|.|..|:..:...|:|::........:||:.|...:|.:||.:|..|:.:|:..
  Fly   311 VFAMEGESTVNYMFMRKQFDYTVQDYSVFNAARVVIQVVGSTIAMILLRRLLGLSTIMMTLLAFA 375

  Fly   458 SIVCSRVLFAFSSSTASFYVAGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIFGISEPIAQFI 522
            ..|....:.|.:...:..|:|.:|.|...:.....|.|.|.:....||.|::|:....:.|:...
  Fly   376 CCVLESTVRATAVYGSEMYLALMVGMMRGVMSPMCKAILSHVTPSSELGKIFSLTTSLQSISPLG 440

  Fly   523 FPPIFSEIYKSTVDSFPGAIWLFGEIFYIPNVLVFVVCYFLLRRRKANEEKSVVEMEQNGGAN 585
            ..|:::.:|::||:.:||       ||...:|.::.:|:.:        ..:|..::::.|:|
  Fly   441 AAPLYTAVYQATVNFYPG-------IFNFISVGLYFLCFCM--------SAAVFGIQKSMGSN 488

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 32/138 (23%)
MFS_1 143..>271 CDD:284993 32/136 (24%)
MFS <379..559 CDD:119392 42/180 (23%)
CG30345NP_724760.2 MFS_1 102..437 CDD:284993 90/405 (22%)
MFS 121..472 CDD:119392 97/428 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C9574512
eggNOG 1 0.900 E1_KOG2816
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I1638
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333052at33208
OrthoFinder 1 1.000 FOG0000485
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23507
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.