DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and CG30344

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_724759.1 Gene:CG30344 FlyBaseID:FBgn0050344 Length:507 Species:Drosophila melanogaster

Alignment Length:585 Identity:122/586 (21%)
Similarity:218/586 (37%) Gaps:124/586 (21%)


  Fly     4 PRSSADA------AG--------NGSGAVDAE--------PKLNYFQKLWRYRHYLVIEPFFFFY 46
            |||..:|      .|        :.|.|..:|        |..:|....|     .::||..|..
  Fly     2 PRSDTEALVADVETGEDSAPRILDASSAASSEQVDPPPVPPPHDYSSYRW-----FILEPAVFLI 61

  Fly    47 FMASVFNAVAMQNFPLDKACRVNLGYNKIVCDTMLDKSELGIECDDFDFENTTQGATPDLADLVI 111
            |.|........||..|.:.|.....:|...|:.:     |||:          :|:..|.     
  Fly    62 FFARNLIGAVYQNQILYQTCITIEKFNATQCEPL-----LGID----------RGSDADK----- 106

  Fly   112 GATGFNYTVCKAELEAQILAADVSGKRAPMAAIFPLIVLLFAGGWADRYNKRKPCMIMPIIGEAL 176
                      :.|:..|..:|::....:.:.:|.|....||.|.|:|::. |:|.::....|...
  Fly   107 ----------EVEVIVQTYSANIMMTTSLLESIIPAFASLFLGPWSDKFG-RRPILLTTFTGYLT 160

  Fly   177 SFTCQIISSIFFESLPMEFGAYCEAIVPALFGGLTFCLM-AIYSYITIATPEEDRVFRFGI-FAM 239
            .....|:.:....|..:....:..:.||::..|.|..|: .||.||:....|..:..|..: .|.
  Fly   161 GALILIVITYITRSTNISPWWFLLSSVPSVVSGGTCALITGIYCYISDVAKERKKALRMVLNEAS 225

  Fly   240 FVTGVPFIGQPISGVLFTTLGYTWSFASAIVFQLIAIFYIIFFIKEVKTTPTTSTTANEPPPLPT 304
            ...|: .:|...||.::........|:.|....:.|:.|::.|:                   |.
  Fly   226 LCAGI-MVGNVASGYIYAATNALVLFSIAGSLMMFALMYVLLFV-------------------PE 270

  Fly   305 SLPPKQQGADNMAYETTNLDELQGNKNVNFQLTPQMEPKVEVVPPKRSLLKELFDPTLVLDCIRF 369
            ||.|                   |:.:..                  |.::|.|...||.|.||.
  Fly   271 SLNP-------------------GDIHTG------------------SRVREFFRFDLVTDLIRT 298

  Fly   370 PLVKRPNNGRMLLILLLCAYFLTVGPTSGENDYWYRFTLKKLAWNGNDFSIYLTLSSGAALVGTF 434
            ...:|||..|.::.|.:.|..:.:....||:...|.|...|..|...|||::........:||:.
  Fly   299 CFKRRPNFDRTIIWLTMIALTIAIFDMEGESTVNYMFVQDKFNWTIKDFSLFNASRIVIQIVGSI 363

  Fly   435 IGTAILSKLLKVSDSMIGMLSALSIVCSRVLFAFSSSTASFYVAGVVDMFVSLRVIAIKTIGSSI 499
            :|..:|.::||:|...:.|||....|....:.|.:......|:...:.|...:.....:.|.|.:
  Fly   364 VGMLVLRRVLKMSIVTMAMLSLACCVLESTVRATAVYWQELYLGMTLGMMRGVMGPMCRAILSHV 428

  Fly   500 VAGDELSKMYSIFGISEPIAQFIFPPIFSEIYKSTVDSFPGAIWLFGEIFYIPNVLVFVVCYFLL 564
            ....|:.|::::....|.::.....|:::.:||:|::::|||       |...:..::.|||.|:
  Fly   429 APATEVGKIFALTTSMESVSPLGAAPLYTTVYKATLENYPGA-------FNFISAALYFVCYILI 486

  Fly   565  564
              Fly   487  486

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 30/132 (23%)
MFS_1 143..>271 CDD:284993 30/130 (23%)
MFS <379..559 CDD:119392 39/180 (22%)
CG30344NP_724759.1 MFS 113..490 CDD:119392 94/440 (21%)
MFS_1 128..448 CDD:284993 80/378 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C9574546
eggNOG 1 0.900 E1_KOG2816
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I1638
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333052at33208
OrthoFinder 1 1.000 FOG0000485
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23507
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.