DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and Y4C6B.5

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_500781.2 Gene:Y4C6B.5 WormBaseID:WBGene00021159 Length:469 Species:Caenorhabditis elegans

Alignment Length:558 Identity:117/559 (21%)
Similarity:204/559 (36%) Gaps:122/559 (22%)


  Fly    32 RYRHYLVIEPFFFFYFMASVFNAVAMQNFPLDKACRVNLGYNKIVCDTMLDKSELGIECDDFDFE 96
            ||...|.:|...|.|.:.|..|....||...:|.|.:....|:..|..:                
 Worm     3 RYLRMLGMEIPLFLYMLGSYLNYPVFQNLIYEKECLIKYQQNETFCRNV---------------- 51

  Fly    97 NTTQGATPDLADLVIGATGFNYTVCKAELEAQILAADVSGKRAPMAAIFP-LIVLLFAGGWADRY 160
                .|..|..|:...|..|.:.                   :.:..:.| |:..|..|...|.:
 Worm    52 ----SAYYDDKDIQAAANHFYFI-------------------SSLTLLCPSLVTTLLLGAATDYW 93

  Fly   161 NKRKPCMIMPIIGEALSFTCQIISSIFFESLPMEFGAYCEAIVPALFGGLTFC--LMAIYSYITI 223
            :.:.| :|:|.||..|.....:..|.|..:     ..|...|..||||   .|  .:||.| .|:
 Worm    94 SIKIP-LIIPYIGCILGTINYVFQSYFIHT-----SVYFLLISDALFG---LCGGFIAIIS-TTL 148

  Fly   224 ATPEEDRVFRFGIFAMFVTGVP-------FIGQPISGVLFTTLGYTWSFASAIVFQLIAIFYIIF 281
            ....:..:.|:..:.  :.||.       .:|..:||.:....||..:|...:..||:|:.|::.
 Worm   149 TYGVKTSMLRYRSYR--IAGVEGAIGLGGTVGFALSGTIREACGYAVTFLIILGLQLLALLYLLG 211

  Fly   282 FIKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNFQLTPQMEPKVEV 346
            ..||.|..|....                        |.|:|....|.:.|              
 Worm   212 LAKETKFEPVRPD------------------------EHTSLISTTGKQLV-------------- 238

  Fly   347 VPPKRSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGPTSGENDYWYRFTLKKL 411
                 ::::|.           :.::.:....|:||||.|.|:.|.:...||.:|..|.:...||
 Worm   239 -----AVIREF-----------YRVITKSRQFRLLLILNLLAFGLEMLVFSGLSDIQYSYLRYKL 287

  Fly   412 AWNGNDFSIYLTLSSG---AALVGTFIGTAILSKLLKVSDSMIGMLSALSIVCSRVLFAFSSSTA 473
            .|....:..:..||.|   ||::  |:...:..||:  ||.|:..|.....:.|..:|||..:..
 Worm   288 QWGDKKYGWFSGLSYGITTAAVL--FLYPLLRMKLM--SDGMLATLGLFFKMISLFMFAFLQNEV 348

  Fly   474 SFYVAGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIFGISEPIAQFIFPPIFSEIYKSTVDSF 538
            ..|...|:.||........:...||::...|..|::|:..:.|.|...:...|::.:|.:|:..|
 Worm   349 MAYSIAVIVMFNRFVSTGFRAFISSLIDMQEQGKIFSVISLLEGITTLVATSIYNNVYPNTLTFF 413

  Fly   539 PGAIWLFGEIFYIPNVLVFVVCYFLLRRRKANEEKSVV 576
            ||.::|...:..:..:.:.....|::|..:....:.::
 Worm   414 PGLLYLISAVTLLIPLAIVSTSDFVVRTHRPEVSEGIL 451

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 33/140 (24%)
MFS_1 143..>271 CDD:284993 33/138 (24%)
MFS <379..559 CDD:119392 49/183 (27%)
Y4C6B.5NP_500781.2 MFS 79..427 CDD:119392 95/418 (23%)
MFS_1 79..399 CDD:284993 88/390 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C9601340
eggNOG 1 0.900 E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333052at33208
OrthoFinder 1 1.000 FOG0000485
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23507
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.