DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and F40F9.5

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_505506.2 Gene:F40F9.5 WormBaseID:WBGene00009582 Length:585 Species:Caenorhabditis elegans

Alignment Length:521 Identity:117/522 (22%)
Similarity:201/522 (39%) Gaps:139/522 (27%)


  Fly   141 MAAIFPLIVLLFAGGWADRYNKRKPCMIMPIIGEALSFTCQIISSIFFESLPMEFGAYCEAIVPA 205
            |..|..|||....|.|:|| |.||..::..:.|..::....:.:::.:|::.:.:..:....:..
 Worm   135 MGTIPTLIVSPLIGNWSDR-NGRKSPLLFSLFGLFINNFILLCATLTYETVNVYYWFFISEFMLG 198

  Fly   206 LFGG--LTFCLMAIYSYITIAT--------PEEDRV-FRFGIFAMFVTGVPFIGQPISGVLFTTL 259
            :|||  .||.     :.:.|.|        |....| ||.|: |.||..:..    ::|.|..:|
 Worm   199 MFGGGAATFS-----TSLAIVTDDCRHKLKPGSSTVPFRVGL-ASFVQSIGM----LNGTLIVSL 253

  Fly   260 ----------GYTWSFASAIVFQ----LIAIFYIIFFIKEVKTTPTTSTTANEPPPLPTSLPPKQ 310
                      .:..|:......|    ||::.|.|||::|                  |..|.|:
 Worm   254 LAVPAIISVERHALSYVECAFIQTALSLISLIYAIFFVRE------------------THFPKKE 300

  Fly   311 QGADNMAYETTNLDELQGNKNVNFQLTPQMEPKVEVVPPK-------RSLLKELFDPTLVLDCIR 368
            ..:.|                   ||....|.:.|.:|||       .|.|:.:|.   ||    
 Worm   301 DFSYN-------------------QLNEAEEVEAEELPPKIIGMRRFTSYLENVFG---VL---- 339

  Fly   369 FPLVKRPNNGRMLLILLLC---AYFLTVGPTSGENDYWYRFTLKKL--AWNGNDFSIYLTLSSGA 428
              .|:||...|:.|.:.|.   ..||:..|.      .....:|:|  |||...|| |.:|:  .
 Worm   340 --TVRRPGWTRLCLCVSLAFVFIEFLSFDPA------LLLLLVKRLPFAWNDKLFS-YFSLT--R 393

  Fly   429 ALVGTFIGTAILSKLLKVS-----DSMIGMLSALSIVCSRV---LFAFSSSTASFYVAGVVDMFV 485
            .||..| |..:...||..|     ||:: :::||:  ||..   |.||::.|...:...:..:.:
 Worm   394 QLVNCF-GMILCPILLTFSHWLGKDSLL-IIAALA--CSAATSFLTAFATRTEHIFYTCIFGIVM 454

  Fly   486 SLRVIAIKTIGSSIVAGDELSKMYSIFGISEPIAQFIFPPIFSEIYKSTVDSFPGAIWLFGEIFY 550
            .....|.::....:||.:|.:::.::..|....:..:...||:.|:..|:..:||..:.....|.
 Worm   455 GGMQPAYRSFLPRMVAKEETARLLTVVSIIISFSPILSSLIFNNIFNMTLTWWPGFAFFVSGCFQ 519

  Fly   551 IPNVLVFVVCYFLLR---------RRKANEE---------KSVVEMEQNGGAN------GGNRAS 591
            |...:..:|.:.|:|         |.:..||         :.:.:.||...:|      .|:|..
 Worm   520 ITVFIGQLVIHMLMRPQWKLDKQLRTRREEETDSRDEPEFRPIGDFEQRSISNTAVDSDSGSRRE 584

  Fly   592 V 592
            |
 Worm   585 V 585

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 33/151 (22%)
MFS_1 143..>271 CDD:284993 32/149 (21%)
MFS <379..559 CDD:119392 45/193 (23%)
F40F9.5NP_505506.2 MFS_1 106..493 CDD:284993 97/428 (23%)
MFS 131..524 CDD:119392 105/459 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333052at33208
OrthoFinder 1 1.000 FOG0000485
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23507
Phylome 1 0.910 0.625 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.880

Return to query results.
Submit another query.