DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and Y43F8A.5

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_507773.1 Gene:Y43F8A.5 WormBaseID:WBGene00012811 Length:475 Species:Caenorhabditis elegans

Alignment Length:574 Identity:97/575 (17%)
Similarity:189/575 (33%) Gaps:165/575 (29%)


  Fly    38 VIEPFFFFYFMASVFNAVAMQNFPLDKACRVNLGYNKIVCDTMLDKSELGIECDDFDFENTTQGA 102
            |....|.:...:|||..| .|:....|||                          ....|:|:  
 Worm     3 VYTTIFLYALTSSVFFPV-FQSLIFYKAC--------------------------ITLSNSTE-- 38

  Fly   103 TPDLADLVIGATGFNYTVCKAE-----------LEAQILAADVSGKRAPMAAIFPLIVLLFAGGW 156
             |::|             ||::           :.:.||.|..:|.         .:...|...|
 Worm    39 -PEIA-------------CKSKETYARDNSVHSMSSVILMASSTGL---------CVSAFFTSRW 80

  Fly   157 ADRYN---KRKPCMIMPIIGEALS-FTCQIISSIFFESLPMEFGAYCEAIVPALFGGLTFCLMAI 217
            ....:   .||...::|.||..:| ||  |:..:.:..|...:....| ::...|||........
 Worm    81 VGHLSDVKSRKLAFLIPFIGLFISDFT--ILIQVLYPRLSPYYFIVSE-VIYGFFGGYMSITSGA 142

  Fly   218 YSYI-TIATPEEDRVFRFGIFAMFVTGVPFIGQPISGVLFTTLGYTWSFASAIVFQLIAIFYIIF 281
            :|.: |:.:.:.:|.  .||..:  .|...:|..: |.|.::....:.:..|..|.|:|.|  |.
 Worm   143 FSIVSTMHSDQRERA--KGIARL--EGTISLGSTV-GFLISSQLKNFGYLGAASFFLVAHF--IA 200

  Fly   282 FIKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNFQLTPQMEPKVEV 346
            |:..|                                               |...|: :|.::.
 Worm   201 FMSAV-----------------------------------------------FMRDPE-KPDLQE 217

  Fly   347 VPPKR-------SLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGPTSGENDYWY 404
            ...||       .|||:...||             ..|.::|.....|:||..:|.|.    ..:
 Worm   218 KCVKRKPFCHGTDLLKDKKPPT-------------STNLKILYFSFACSYFAFIGSTR----ILF 265

  Fly   405 RFTLKKLAWNGNDFSIYLTLSSGAALVGTFIGTAILS-------KLLKVSDSMIGMLSALSIVCS 462
            .:...:..|...:|.....:::|.        |.|:|       |.|.::|..:.:...|:....
 Worm   266 FYLKHRFFWGAEEFGYLKAMNTGM--------TTIMSLALYPFLKNLGITDIRLAIFGLLTRSIG 322

  Fly   463 RVLFAFSSSTASFYVAGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIFGISEPIAQFIFPPIF 527
            |..:|.:....:.::....:||......|:::..::.|...|....:|:..:.|.:.......:|
 Worm   323 RAWYAVAWEGWTVFIVVFFEMFSKFPATAMRSSIATNVGEHERGLAFSLVAVIEALCNLTSSWVF 387

  Fly   528 SEIYKSTVDSFPGAIWLFGEIFYIPNVLVFVVCYFLLRRRKANEEKSVVEMEQN 581
            ...:..:::.||...::...|..:|.:.:.::....|...:.|.|.....::::
 Worm   388 HLAWPLSLNVFPQLSFVIMPIIILPAITLMILNMRYLEAPELNPEDLTTSIKKS 441

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 26/135 (19%)
MFS_1 143..>271 CDD:284993 26/133 (20%)
MFS <379..559 CDD:119392 30/187 (16%)
Y43F8A.5NP_507773.1 MFS 56..418 CDD:119392 78/454 (17%)
MFS_1 56..378 CDD:284993 73/414 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C9601335
eggNOG 1 0.900 E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000485
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23507
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.890

Return to query results.
Submit another query.