DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and SLC46A1

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_542400.2 Gene:SLC46A1 HGNCID:30521 Length:459 Species:Homo sapiens

Alignment Length:423 Identity:85/424 (20%)
Similarity:154/424 (36%) Gaps:91/424 (21%)


  Fly   148 IVLLFA----GGWADRYNKRKPCMIMPIIGEALSFTCQIISSIFFESLPMEFGAY-CEAIVPAL- 206
            :|.||:    |.|:|... |:|.:::..:|..|    |.:.|:|...|.:..|.: ...|:.|| 
Human    95 LVGLFSSTLLGAWSDSVG-RRPLLVLASLGLLL----QALVSVFVVQLQLHVGYFVLGRILCALL 154

  Fly   207 --FGGLTFCLMAIYSYITIATPEEDRVFRFGIFAMFVTGVPFIGQPISGVLFTTLGYTWSFASAI 269
              ||||   |.|.::.:...:....|.||..:....:.....:...:.|......||...|..|:
Human   155 GDFGGL---LAASFASVADVSSSRSRTFRMALLEASIGVAGMLASLLGGHWLRAQGYANPFWLAL 216

  Fly   270 VFQLIAIFYIIFFIKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNF 334
            ...:....|..|...|         |..||                   ::|.|...:.::::  
Human   217 ALLIAMTLYAAFCFGE---------TLKEP-------------------KSTRLFTFRHHRSI-- 251

  Fly   335 QLTPQMEPKVEVVPPKRSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGPTSGE 399
                                            ::..:...|...|..|.|...|.|:.:....|.
Human   252 --------------------------------VQLYVAPAPEKSRKHLALYSLAIFVVITVHFGA 284

  Fly   400 NDYWYRFTLK-KLAWNGNDFSIYLTLSSGAALVGTFIGTAILS-KLLK--VSDSMIGMLSALSIV 460
            .|....:.|. .|.|:..      .:..|:|.......|::|: |||:  ::|:.:..:.....:
Human   285 QDILTLYELSTPLCWDSK------LIGYGSAAQHLPYLTSLLALKLLQYCLADAWVAEIGLAFNI 343

  Fly   461 CSRVLFAFSSSTASFYVAGVVDMFVSLRVI-AIKTIGSSIVAGDELSKMYSIFGISEPIAQFIFP 524
            ...|:|||::.|...: .|...:|:||.:. .|:...|.:|...|...::|.......:|.....
Human   344 LGMVVFAFATITPLMF-TGYGLLFLSLVITPVIRAKLSKLVRETEQGALFSAVACVNSLAMLTAS 407

  Fly   525 PIFSEIYKSTVDSFPGAIWLFGE-IFYIPNVLV 556
            .||:.:|.:|::...|..:|.|. :..||.||:
Human   408 GIFNSLYPATLNFMKGFPFLLGAGLLLIPAVLI 440

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 32/131 (24%)
MFS_1 143..>271 CDD:284993 32/131 (24%)
MFS <379..559 CDD:119392 44/185 (24%)
SLC46A1NP_542400.2 MFS 73..443 CDD:119392 85/424 (20%)
MFS_1 94..407 CDD:284993 74/389 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C9582887
eggNOG 1 0.900 E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333052at33208
OrthoFinder 1 1.000 FOG0000485
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23507
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.