DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and si:ch211-262i1.4

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_021328126.1 Gene:si:ch211-262i1.4 ZFINID:ZDB-GENE-140106-10 Length:351 Species:Danio rerio

Alignment Length:382 Identity:71/383 (19%)
Similarity:140/383 (37%) Gaps:96/383 (25%)


  Fly   126 EAQILAADVSGKRAPMAAIFPLIVLLFAGGWADRYNKRKPCMIMPIIGEALSFTCQIISSIFFES 190
            :||.:::.....::.::::..::.::.....||.:.. |..::...:|..|.....:|  ..:..
Zfish    44 QAQAMSSRFLLIQSVLSSVMAMLSIIPLSRMADHHGP-KVFLVSSQMGSVLGMFTLVI--FMYCE 105

  Fly   191 LPMEFGAYCEAIVPALFGGLTFCLMAIYSYITIATPEEDRVFRFGI--FAMFVTGVPFIGQPISG 253
            :|:|| .|..:::..|.||.......:.:..::::.:..|..:..|  |...:.||  :|..:||
Zfish   106 VPLEF-LYLGSLLHGLSGGGPMFWAGVAALASLSSEQRKRTLKLNIVDFCFGIAGV--VGGLLSG 167

  Fly   254 VLFTTLGYTWSFASAIVFQLIAIFYIIFFIKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAY 318
            .|: .:|.:....:||:...:|:.|.:|.:.:.:                .|......||:|:. 
Zfish   168 YLY-QVGPSVLLLTAILITTVALLYSVFALSDSR----------------LSYSEGMVGAENVL- 214

  Fly   319 ETTNLDELQGNKNVNFQLTPQMEPKVEVVPPKRSLLKELF--DPTLVLDCIRFPLVKRPNNGRML 381
                                                 :||  .|.|..|.: :....|.....|.
Zfish   215 -------------------------------------QLFVLKPPLSWDSV-WAGYGRAATSAMY 241

  Fly   382 L--ILLLCAYFLTVGPTSGENDYWYRFTLKKLAWNGNDFSIY-LTLSSGAALVGTFIGTAILSKL 443
            |  .|.:.:.|..:|.|:        .||..:..|....:|. .|:.|....:|...|  :|..|
Zfish   242 LSSFLAVLSLFNVMGDTA--------LTLLGIVSNCTGMAIMAFTMESWIYFLGRVFG--LLQLL 296

  Fly   444 LKVSDSMIGMLSALSIVCSRVL----------FAFSSSTASFYVAGVVDMFVSLRVI 490
            |.|:|       .||.||...:          |.|..|.|..|::.|..:::|.|.:
Zfish   297 LAVTD-------LLSNVCFTSIYPLTLRWFSGFCFILSCAISYISAVPIIYLSGRTL 346

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 25/132 (19%)
MFS_1 143..>271 CDD:284993 25/130 (19%)
MFS <379..559 CDD:119392 31/126 (25%)
si:ch211-262i1.4XP_021328126.1 MFS_1 57..342 CDD:331686 67/364 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C9583846
eggNOG 1 0.900 E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333052at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23507
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.