DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and slc46a3

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_002934077.1 Gene:slc46a3 XenbaseID:XB-GENE-984436 Length:473 Species:Xenopus tropicalis

Alignment Length:531 Identity:124/532 (23%)
Similarity:202/532 (38%) Gaps:136/532 (26%)


  Fly    36 YLVIEPFFFFYFMASVFNAVAMQNFPLDKACRVNLGYNKIVCDTMLDKSELGIECDDFDFENTTQ 100
            :.::||....|..||.|      .|||         ..:.|...||      ||.....|.|   
 Frog    17 FRLVEPVVAIYCFASFF------TFPL---------IQQYVYSRML------IEGSSDGFIN--- 57

  Fly   101 GATPDLADLVIGATGFNYTVCKAELE--AQILAADVSGKRA-------PMAAIFP-LIVLLFAGG 155
                          |.|.:.|:....  |.|...:|. |||       .::|:.| |::.|....
 Frog    58 --------------GNNISHCETNQSDPAYIHQKEVQ-KRASLFSSTLDLSALIPSLVMALILVS 107

  Fly   156 WADRYNKRKPCMIMPIIGEALSFTCQIISSIFFESLPMEFGAYCEAIVPALFGGLTFCLMAIYSY 220
            :.||:. ||..:::|.:|..||..  |..:|.|.:||:.. .|...::....||....:...:||
 Frog   108 YGDRHG-RKASILLPCLGALLSVL--IYCAIAFFTLPLAV-LYLSYVISGFMGGFATFIGGCFSY 168

  Fly   221 IT-IATPEEDRVFRFGIFAMFVTGVPF-IGQPISGVLFTTLGYTWSFASAIVFQLIAIFYIIFFI 283
            :. ::...:.:..|.. |...|.||.. :....||.....||:.|||....:..:|.|.||.||:
 Frog   169 VADLSKDAQKKNIRIA-FVDMVLGVSSGLAGIASGYFIRELGFNWSFLIPGLLHIINICYICFFL 232

  Fly   284 KEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNFQLTPQMEPKVEVVP 348
            :|     |...:..:.|.|      .::|                                    
 Frog   233 EE-----TVQRSEFQQPVL------SKEG------------------------------------ 250

  Fly   349 PKRSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGPTSGENDYWYRFTLKK--- 410
                 ..|||....:|  .|....|:    |::|.|||.|:.|.:....|....   |||.:   
 Frog   251 -----FTELFTGVFLL--FRNASCKK----RVVLTLLLLAFMLYLLANFGAVSL---FTLYELDA 301

  Fly   411 -LAWN------GNDFSIYLTLSSGAALVGTFIGTAILSKLLKVSDSMIGMLSALSIVCSRVLFAF 468
             |.|:      |:.||.:       ..||:|.|..:.|:.||  |:.|..:...|.:...:|.||
 Frog   302 PLCWDSVLVGWGSAFSTF-------CFVGSFFGVYLFSRCLK--DAYIVFIGMTSWIGGIILVAF 357

  Fly   469 SSSTASFYVAGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIFGISEPIAQFIFPPIFSEIYKS 533
            |::|.:..:..:..:|.::.:..:::|.|.:|..:|...:::.....|.|...:...|||.:|.:
 Frog   358 STTTIAMMLVRIPLLFAAMPLPVLRSIMSKVVLENEQGALFACIACLESITGVLTITIFSAVYAA 422

  Fly   534 TVDSFPGAIWL 544
            ||..|||..:|
 Frog   423 TVMWFPGFSFL 433

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 34/133 (26%)
MFS_1 143..>271 CDD:284993 34/131 (26%)
MFS <379..559 CDD:119392 48/177 (27%)
slc46a3XP_002934077.1 MFS 88..443 CDD:119392 99/422 (23%)
MFS_1 95..411 CDD:284993 88/391 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333052at33208
OrthoFinder 1 1.000 FOG0000485
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.