DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and slc46a2

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_017953045.1 Gene:slc46a2 XenbaseID:XB-GENE-988711 Length:444 Species:Xenopus tropicalis

Alignment Length:433 Identity:77/434 (18%)
Similarity:161/434 (37%) Gaps:71/434 (16%)


  Fly   143 AIFPLIVLLFAGGWADRYNKRKPCMIMPIIGEALSFTCQIISSIFFESLPMEFGAYCEAIVPALF 207
            |:.|::.........|:.:::.| :.:|::|..:|....:...:|...:.:.||:   |.:..|.
 Frog    63 ALTPILSAYILANIGDKKSRKVP-ICVPLLGYFVSRMFLLFVILFNWPIEVMFGS---AALNGLT 123

  Fly   208 GGLTFCLMAIYSYITIATPEEDRVFRFGIFAMFVTGVPFIGQPISGVLFTTLGYTWSFASAIV-- 270
            |..|.....:.:..::.:.|..|..|..|..:......|:|..:||.:|..........|.:|  
 Frog   124 GFFTTYWAGVLAVASLGSSESKRSVRIIIIELVYGVAGFVGSLVSGHIFKNFDIANQKGSVLVIL 188

  Fly   271 ---FQLIAIFYIIFFIK--EVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQGNK 330
               |...::.|.:|..|  .::.|...:|.:.|...|....|.:...|:.               
 Frog   189 SLCFYAFSLIYSLFIFKIPRIEETGPGNTESTETSTLLMKNPTETSTANG--------------- 238

  Fly   331 NVNFQLTPQMEPKVEVVPPKRSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGP 395
                                                     |...::.::.|:||..:..|....
 Frog   239 -----------------------------------------VTMTSSSKVFLVLLFLSAILYNAA 262

  Fly   396 TSGENDYWYRFTLKK-LAWNGNDFSIYLTLSSGAALVGTFIGTAILSKLLKVSDSMIGMLSALSI 459
            ..|..|....|.:|: |:|...:.. |...:.....|.:|:|....||  :::|.::..:..||.
 Frog   263 VGGAVDVLPFFIIKEPLSWGAVEVG-YANAAGYLIFVTSFLGVYFFSK--RLTDFVMIGIGILSF 324

  Fly   460 VCSRVLFAFSSSTASFYVAGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIFGISEPIAQFIFP 524
            .....:..|...|..||||.||.||..:.:..|:::.|..|.|....|::.:..:...|...:..
 Frog   325 SAGIFIMGFVQWTFLFYVARVVMMFSLIPLPTIRSVISKHVQGSSYGKVFVVLQLLLSITHVVTL 389

  Fly   525 PIFSEIYKSTVDSFPGAIWLFGEIFYIPNVLVFVVCYFLLRRR 567
            ..|:::|::::..|.|..::...|..:.:::...:..::.:.|
 Frog   390 ISFTKLYQASLKWFHGLCFILASIIALLSLIPIRIAAYMHQSR 432

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 25/133 (19%)
MFS_1 143..>271 CDD:284993 25/133 (19%)
MFS <379..559 CDD:119392 40/181 (22%)
slc46a2XP_017953045.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C9582664
eggNOG 1 0.900 E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333052at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.