DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and LOC100487354

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_017953038.1 Gene:LOC100487354 ID: Length:384 Species:Xenopus tropicalis

Alignment Length:389 Identity:82/390 (21%)
Similarity:135/390 (35%) Gaps:98/390 (25%)


  Fly   146 PLIVLLFAGGWADRYNKRKPCMIMPIIGEALSFTCQIISSIFFESLPME--FGAYCEAIVPALFG 208
            ||:........:|: ...|..:.:|:.|..:| ...::..|.|| .|:|  ||:       |.|.
 Frog    66 PLLSAYILAKISDK-TSTKVTICVPLTGYLIS-RMFLLFVILFE-WPIEVIFGS-------AAFN 120

  Fly   209 GLTFCL----MAIYSYITIATPEEDRVFRFGIFAMFVTGVPFIGQPISGVLFTTLGY-------- 261
            |||...    ..:.::.::|:.|..|..:..|..:......|.|..:||.:|..|..        
 Frog   121 GLTGWFTTYWAGVMAWASLASTESKRSLKLIIIELVYGLAGFAGSLVSGYIFVHLNINKHQGTIL 185

  Fly   262 ----TWSFASAIVFQLIAIFYIIFFIKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTN 322
                |..:|       ..:.|.||.:|    .|...|...|.....:|:....|.:.|......|
 Frog   186 ASCSTGCYA-------FCVLYSIFILK----MPDAETCLEERNTEGSSINEASQESINSDCALLN 239

  Fly   323 LDELQGNKNVNFQLTPQMEPKVEVVPPKRSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLC 387
             |:...|..:|        |. :|...|               |:             ::.:.:.
 Frog   240 -DKPTNNTAIN--------PS-DVASSK---------------CV-------------IICMFVS 266

  Fly   388 AYFLTVGPTSGENDYWYRFTLKK-LAW--------NGNDFSIYLTLSSGAALVGTFIGTAILSKL 443
            |....:..|: .:|....|.||| |.|        |...:..|:|         :|:|..|.||.
 Frog   267 AIVYNIAVTA-TDDVINVFVLKKPLNWGPVEVGYGNAAAYMTYIT---------SFLGVYIFSKC 321

  Fly   444 LKVSDSMIGMLSALSIVCSRVLFAFSSSTASFYVAGVVDMFVSLRVIAIKTIGSSIVAGDELSK 507
            .  .|..:.:...:|..|..::.||...|..:|:|..|.:|..:....|::|.|..|.|....|
 Frog   322 F--GDLGLIITGMISFSCGILIMAFVRWTYLYYIARAVMLFSLITTPTIRSIISKHVKGSSYGK 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 31/143 (22%)
MFS_1 143..>271 CDD:284993 31/143 (22%)
MFS <379..559 CDD:119392 33/139 (24%)
LOC100487354XP_017953038.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333052at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.