DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and LOC100487203

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_002936740.2 Gene:LOC100487203 ID: Length:449 Species:Xenopus tropicalis

Alignment Length:505 Identity:105/506 (21%)
Similarity:192/506 (38%) Gaps:108/506 (21%)


  Fly   109 LVIGA--------TGFNYTVCKAELEAQILAADVSGKRAPMAAIF-------------PLIVLLF 152
            :|.||        ||...|| |......|.::::|...|...||.             ||:...|
 Frog    11 VVAGAQVASSFYDTGLLMTV-KNYYNQTINSSNISSDEALQKAISNFYIVYNSIMGLGPLLSAYF 74

  Fly   153 AGGWADRYNKRKPCMIMPIIGEALSFTCQIISSIFFESLPMEFGAYCEAIVPALFGGLTFCLMAI 217
            ....:|:.| ||..:.:|:.|..:|....:...::...:.:.||:   |.:..|.|..|.....:
 Frog    75 LAKISDKIN-RKITICVPLTGYLISRMFLLFVILWDWPIEVMFGS---AALNGLTGWFTAYWAGV 135

  Fly   218 YSYITIATPEEDRVFRFGIFAMFVTGVPFIGQPISGVLFTTLGYTWSFASAIVFQ------LIAI 276
            .::.::|:.|..|..:..|..:......|.|...||.:|..:... ....||:..      :..:
 Frog   136 MAWASLASTESKRSIKLIIIELVYGLAGFAGSLASGHIFVHININ-HHQGAILASCSLGCYVFCV 199

  Fly   277 FYIIFFIKEVKTTPTT-------STTANEPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNF 334
            .|..|.:|  ..:|.|       .||.||           .|..|:   |.|....|.|:|::  
 Frog   200 LYSTFVLK--IPSPETGCIETNEGTTINE-----------TQKEDS---EYTERSRLLGDKSL-- 246

  Fly   335 QLTPQMEPKVEVVPPKRSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGPTSGE 399
            |...|        |.:|:              .:|.|:.        :.:.:..|.:..|   |.
 Frog   247 QTLNQ--------PHQRT--------------TKFILIS--------IFISVILYNIAAG---GA 278

  Fly   400 NDYWYRFTLKK-LAWNGNDFSIYLTLSSGAALVGTFIGTAILSKLLKVSDSMIGMLSALSIVCSR 463
            .|....|.||| |:|...|.. |...::....:.:|:|..:.|  :.|.|..:.::..:|..|..
 Frog   279 EDVINVFVLKKPLSWGPVDVG-YGNAATYINYITSFLGVYVFS--MCVGDLGLIIIGMISFSCGI 340

  Fly   464 VLFAFSSSTASFYVAGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIFGISEPIAQFIFPPIFS 528
            ::.||...|..:|||..|.||..:....|:::.|..|......|::::..::..:.........:
 Frog   341 LIMAFVQWTYLYYVARAVMMFSLIPTPIIRSLISKHVQESLYGKVFAVLQLAIGVVYVSSSAGLN 405

  Fly   529 EIYKSTVDSFPGAIWL----FGEIFYIPNVLVFVVCYFLLRRRKANEEKS 574
            ::|::|:|.:.|..:|    .|.:..||  ::...|       |.::|::
 Frog   406 KLYQATLDWYSGFCFLLFSTLGFLSAIP--VIIAAC-------KQHQERA 446

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 29/143 (20%)
MFS_1 143..>271 CDD:284993 29/141 (21%)
MFS <379..559 CDD:119392 40/185 (22%)
LOC100487203XP_002936740.2 MFS_1 62..395 CDD:284993 81/392 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333052at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.