DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and mfsd14b

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001135533.1 Gene:mfsd14b ID: Length:475 Species:Xenopus tropicalis

Alignment Length:530 Identity:97/531 (18%)
Similarity:180/531 (34%) Gaps:155/531 (29%)


  Fly   109 LVIGATGFNYTVCKAELEAQILAA--DVSGKRAPMAAIFPLIVLLFAGGWADRYNKRKPCMIMPI 171
            |:.|..||...:|     |.::.|  ||.|:::     |.|:.:.|.            |..:|:
 Frog    61 LIQGVKGFLSFMC-----APLIGALSDVYGRKS-----FLLLTVFFT------------CFPIPL 103

  Fly   172 IGEALSFTCQIISSIFFESLPMEFGAYCEAIVPALFGGLTFCLMAIYSYITIATPEEDRVFRFGI 236
            :.         ||..::.::....||:          .:||.:  |::|:...|.|.:|...:|:
 Frog   104 MR---------ISPWWYFAMISVSGAF----------SVTFSV--IFAYVADITQEHERSTAYGL 147

  Fly   237 ----FAMFVTGVPFIGQPISGVLFTTLGYTWSFASAIVFQLIAIFYIIFFIKEVKTTPTTSTTAN 297
                ||..:...|.||..||......|       ..:|..::|:..|.|.:..|           
 Frog   148 VSATFAASLVTSPAIGAYISEFYGDNL-------VVLVATVVALLDICFILLAV----------- 194

  Fly   298 EPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNFQLTPQMEPKVEVVPPKRSLLKELFDPTL 362
             |..|...:.|...||. :::|..:                          |..||.|...|.|:
 Frog   195 -PESLREKMRPTTWGAP-ISWEQAD--------------------------PFASLKKIGKDTTV 231

  Fly   363 VLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGPTSGENDYWYRFTLKKLAWNGNDFSIYLTLSSG 427
            :|.||                    ..||:..|.:|:...::.:..:.:.:|....:.::.:...
 Frog   232 LLICI--------------------TVFLSYLPEAGQYSSFFLYLRQIIGFNSGSIAAFIAVVGI 276

  Fly   428 AALVGTFIGTAILSKLLKVSDSMIGMLSALSIVCSRVL-FAFSSSTASFYVAGVVDMFVSLRVIA 491
            .::|..   |.:||.|::...:...:|..|.....::. :.|.|.....:.||.|....|:...|
 Frog   277 LSIVAQ---TVLLSILMRSIGNKNTVLLGLGFQMFQLAWYGFGSQPWMMWAAGAVAAMSSITFPA 338

  Fly   492 IKTIGSSIVAGDELSKMYSIF--------GISEPIAQFIF------------PPIFSEIYKSTVD 536
            :..:.|.....|:......:.        |:...:..|:|            .|...:......|
 Frog   339 VSALISRNAESDQQGVAQGMVTGIRGLCNGLGPALYGFVFFLFHVELNGIVPVPSSDKPENDPSD 403

  Fly   537 S---FPGAIWLFGEIFYIPNVLVFVVCYFL-------LRRRKANEEKSVVEMEQNGGANGGNRAS 591
            |   .||..:|||....:   |.|:|..|:       .:.....:..|::...|...:..|:...
 Frog   404 STSVIPGPPFLFGACAVL---LAFLVALFIPEHSSHSSKNTSGGKHSSMISSTQTSNSGRGSDED 465

  Fly   592 VVP---DSEI 598
            :.|   ||.:
 Frog   466 IEPLLQDSSV 475

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 26/134 (19%)
MFS_1 143..>271 CDD:284993 26/132 (20%)
MFS <379..559 CDD:119392 34/204 (17%)
mfsd14bNP_001135533.1 MFS 25..378 CDD:119392 78/429 (18%)
MFS_1 27..371 CDD:284993 77/422 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D763423at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.