DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and slc46a1

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001120610.1 Gene:slc46a1 XenbaseID:XB-GENE-961470 Length:462 Species:Xenopus tropicalis

Alignment Length:494 Identity:90/495 (18%)
Similarity:170/495 (34%) Gaps:128/495 (26%)


  Fly    95 FENTTQG--ATPDLADLVIGATGFNYTVCKAELEAQILAADVSGKRAP----------------- 140
            |....||  .|..|.|.:....|||.|        :||...|:|.::.                 
 Frog    35 FALALQGPLTTQYLWDRLSADIGFNGT--------RILDCTVNGSKSTGALQQEVETLTSHWSLY 91

  Fly   141 ------MAAIFPLIVLLFAGGWADRYNKRKPCMIMPIIGEALSFTCQIISSIFFESLPMEF---G 196
                  :..:|.:::|   |.|:|:.. |:|.:..|.||.||.....::  :.::.|.:.:   |
 Frog    92 INLGGFLVGLFSVMLL---GPWSDKVG-RRPVLFFPCIGLALQAALYLV--VMYQELHVAYFLIG 150

  Fly   197 AYCEAIVPALFGGLTFCLMAIYSYITIATPEEDRVFRFGIFAMFVTGVPFIGQPISGVLFTTLGY 261
            .:    :..:.|.....|...::||...:..:.|.||..|....:        .|:|::.:.:|.
 Frog   151 RF----ISGISGDFNMILAGCFAYIADVSDRQSRTFRVAILEACL--------GIAGMVASIIGG 203

  Fly   262 TWSFASA------IVF--QLIAIFYIIFFIKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAY 318
            .|..|..      :||  .|....|:.|.::|       |....:|..|.|          :..|
 Frog   204 HWRKAQGYINPFWLVFAVNLFTAVYVYFCVEE-------SVKDKKPARLFT----------HRHY 251

  Fly   319 ETTNLDELQGNKNVNFQLTPQMEPKVEVVPPKRSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLI 383
            :|                                             ..|...|...||.|..|.
 Frog   252 QT---------------------------------------------FFRLFTVSGENNRRRKLC 271

  Fly   384 LLLCAYFLTVGPTSGENDYWYRFTLK-KLAWNGNDFSIYLTLSSGAALVGTFIGTAILSKLLKVS 447
            |...|..:.|....|..:.:..:.|. .|.|: :|...|.:.:.....:.:..|..:..  |.::
 Frog   272 LYSLALLVVVTVHMGAKNLFVLYELSYPLCWD-SDLIGYGSAAEHLTYLSSLAGLRLFQ--LCLA 333

  Fly   448 DSMIGMLSALSIVCSRVLFAFSSSTASFYVAGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIF 512
            ||.:..:..:|.:...|:.:.:|:|...:....:..|.......|::..|.:|...|...::|..
 Frog   334 DSWVAEMGFISNISGLVVISLASTTPVMFTGYGLRFFAMATTPVIRSKLSKMVEEGEQGALFSSV 398

  Fly   513 GISEPIAQFIFPPIFSEIYKSTVDSFPGAIWLFGEIFYI 551
            ...|.::..:...:|:.:|.:|:....|..:|||.:..:
 Frog   399 ACVEGLSYLLATAVFNSLYPATLHFMQGFPFLFGALLLL 437

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 28/139 (20%)
MFS_1 143..>271 CDD:284993 28/137 (20%)
MFS <379..559 CDD:119392 33/175 (19%)
slc46a1NP_001120610.1 MFS 79..446 CDD:119392 76/443 (17%)
MFS_1 97..410 CDD:284993 69/396 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C9583147
eggNOG 1 0.900 E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333052at33208
OrthoFinder 1 1.000 FOG0000485
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.