DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG9737

DIOPT Version :10

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:55 Identity:12/55 - (21%)
Similarity:22/55 - (40%) Gaps:10/55 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GVNGGESYENCSPWLSYATAKNKTCYNLCVHNCAAVYDGSCINDRRFKCCLATFP 84
            |:..||        ..:.||.|  .|::.|:...|..:...::.:.:|....|.|
  Fly    50 GIIMGE--------FGFITADN--VYHVTVYATDADGNFKIVSMKNYKLGPTTLP 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 38..258 CDD:238113 9/47 (19%)
CG9737NP_651783.1 CLIP 28..89 CDD:463440 10/48 (21%)
Tryp_SPc 149..406 CDD:214473
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.