DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG8952

DIOPT Version :10

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:236 Identity:69/236 - (29%)
Similarity:108/236 - (45%) Gaps:47/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVSITAIRIKG------NSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAH-SCGGAIINET 72
            ||.:.||.:.|      ||:..:.  |.||:.|..|:.|..|:|:.|:..:... .|||:||::|
  Fly    11 LVLLAAISVVGQPFDPANSSPIKI--DNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDT 73

  Fly    73 FVLTAAHCVENAFIPWLVVVT----GTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEP 133
            :|||||||.......:|:..|    ..|..|.....     |.||.:| |.:::||::|::|.||
  Fly    74 WVLTAAHCTNGLSSIFLMFGTVDLFNANALNMTSNN-----IIIHPDY-NDKLNNDVSLIQLPEP 132

  Fly   134 IAWDERTQPIPLPLVPMQPGDEVILTGWGSTVL-WGTSPIDLQVLYLQY-----------VPHRE 186
            :.:....|.|.|   ..|.||.:...|..:|:. :|.:..:    ||.|           :.:.:
  Fly   133 LTFSANIQAIQL---VGQYGDSIDYVGSVATIAGFGYTEDE----YLDYSETLLYAQVEIIDNAD 190

  Fly   187 C-----KALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLV 222
            |     |.::.:...|..|    |.......|.|||||||:
  Fly   191 CVAIYGKYVVVDSTMCAKG----FDGSDMSTCTGDSGGPLI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 38..258 CDD:238113 60/207 (29%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 61/208 (29%)

Return to query results.
Submit another query.