DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG6041

DIOPT Version :10

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:87 Identity:21/87 - (24%)
Similarity:36/87 - (41%) Gaps:12/87 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ALRILAALCF--LTAVATITLNLCQEFCAGVNGGESYENCSPWLSYATAKNKTCYNLCVHNCAAV 65
            |..:|..|||  |..:..:.|     |..|:.....:|....:: |:........|:|:.  ..|
  Fly   194 ARALLLFLCFYVLAELPYVLL-----FSVGLYNPADFEQLDEYI-YSQVDIFIYANMCLG--ILV 250

  Fly    66 YDGSCINDRRFKCCLATFPAKK 87
            |  |.::.:..|..:|||..:|
  Fly   251 Y--SLMSSQYRKTVIATFWRRK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 38..258 CDD:238113 12/50 (24%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 20/84 (24%)

Return to query results.
Submit another query.