DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr8a and Gr21a

DIOPT Version :8

Sequence 1:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001259841.1 Gene:Gr21a / 33251 FlyBaseID:FBgn0041250 Length:447 Species:Drosophila melanogaster

Alignment Length:421 Identity:84/421 - (19%)
Similarity:153/421 - (36%) Gaps:121/421 - (28%)


  Fly    13 LRLYQVLGFHGLPL---PGDGNPART-----RRRLMAWSLFLLISLSALVLACLFSG-EEFLYRG 68
            |.|:|::|.  :|:   |.:.|..||     .:::| |::|:....:.:|:..|... ::|:...
  Fly    78 LVLFQIMGV--MPIHRNPPEKNLPRTGYSWGSKQVM-WAIFIYSCQTTIVVLVLRERVKKFVTSP 139

  Fly    69 D-MFGCANDAL-KYVFAELGVLAIYLETLSSQRH------LANFW----WLHFKLGGQKTGLVSL 121
            | .|   ::|: ..:|..| :...:|..::|.||      ..|.|    :..||..|......:|
  Fly   140 DKRF---DEAIYNVIFISL-LFTNFLLPVASWRHGPQVAIFKNMWTNYQYKFFKTTGSPIVFPNL 200

  Fly   122 RSEFQQFCRYLIFLYAMMAAEVAIHLGLWQFQALTQHMLLFWST--YEPLV---------WL--- 172
            .......|   :|.:.:   .:||:|.    |...|.....|.|  |.|::         |.   
  Fly   201 YPLTWSLC---VFSWLL---SIAINLS----QYFLQPDFRLWYTFAYYPIIAMLNCFCSLWYINC 255

  Fly   173 ----TYLRNLQFVLHLELLREQLTGLEREMGLLAEYSRFASETGRSFPGFESFLRRRLVQKQRIY 233
                |..|.|.     :.|:..:.| |:....|.||.....:           |...:.|..|.|
  Fly   256 NAFGTASRALS-----DALQTTIRG-EKPAQKLTEYRHLWVD-----------LSHMMQQLGRAY 303

  Fly   234 SHVYDMLKCFQGAFNFSILAVLLTINIRIAVDCYFMYYSIYNNVINNDYYLIVPALLEIPAFIYA 298
            |::|.|         :.::....||   ||.      |...:.:|::.     ....|:..|:..
  Fly   304 SNMYGM---------YCLVIFFTTI---IAT------YGSISEIIDHG-----ATYKEVGLFVIV 345

  Fly   299 SQSCMVVVPRIAHQLHNIVTDSGCCSCPDLSLQIQNFSLQLL-----------------HQPI-R 345
            .. ||.::..|.::.|......|.    |...::.|.:|..:                 :.|| .
  Fly   346 FY-CMGLLYIICNEAHYASRKVGL----DFQTKLLNINLTAVDAATQKEVEMLLVAINKNPPIMN 405

  Fly   346 IDCLGLTILDCSLLTRMACSVGTYMIYSIQF 376
            :|  |...::..|:|.....:.||::..:||
  Fly   406 LD--GYANINRELITTNISFMATYLVVLLQF 434

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 82/419 (20%)
Gr21aNP_001259841.1 7tm_7 75..438 CDD:285581 84/421 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.