DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr8a and gur-3

DIOPT Version :8

Sequence 1:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_509743.2 Gene:gur-3 / 181245 WormBaseID:WBGene00001804 Length:447 Species:Caenorhabditis elegans

Alignment Length:371 Identity:71/372 (19%)
Similarity:125/372 (34%) Gaps:136/372 (37%)


  Fly   107 LHFKLGGQKTGLVSLR--SEFQQ---------FCRYLIF-LYAMMAAEVAIHLGLWQFQALTQHM 159
            |.||....::...|.|  ::.:|         :|..::. ||:.|..     |||....:..::.
 Worm     9 LEFKWTSPRSSRSSFRTTTDAEQKISIDMSNTYCDQVLGPLYSYMMV-----LGLNHTHSSARNT 68

  Fly   160 LLFWSTYEPLVWLTYL----------RNLQFVLHLELLREQLTGLEREMGL-------------- 200
            :..|    ||....||          |.:.     ::.::..|..|::...              
 Worm    69 MFKW----PLTIYNYLTLAILTAATIRRIS-----QIKQKSATNEEKDAAFHVLNPTFVLTLCHA 124

  Fly   201 LAEYSRFASETGRSFPGFESFLRRRLVQKQRIY----------------SHVYDMLKCFQGAFNF 249
            |..:|..|:       ||  .|.:...|::::|                ||.:.:.|.|. :.:|
 Worm   125 LLMFSGLAA-------GF--LLLKLQKQREKMYHVLDQGLGRNRNEEHDSHHFKLNKLFI-SISF 179

  Fly   250 SILAVLLTINIRIAVDCYFMYYSIYNNVINNDYYLIVPALLEIPAFIYASQSCMVVVPRIAHQLH 314
            |..|.|..  ::||....::......::||...|.::   || ...|:.:.||:.:|..:..||.
 Worm   180 SFAAALSF--VQIATKMRYLDLPDTPDLINRKIYFVI---LE-GYVIFIASSCISLVAILFFQLC 238

  Fly   315 NIV-------------TDSGCCSCPDLSLQ-------------------IQNFSLQLLHQ---PI 344
            .|:             .:...|..|:.|||                   .||||..|.:.   .|
 Worm   239 RILQFSIGQLIEEMVPKEKEECPLPEQSLQQIHDVQIHYQEISNAKLYIEQNFSFSLFYTYGCCI 303

  Fly   345 RIDCL--------GLTI-----------LDCSLLTRMACSVGTYMI 371
            .:.||        |:..           |..::|..|..|:..:||
 Worm   304 PLTCLLGYIAFRNGIQADMAETFSVAIWLTNTMLALMLFSIPAFMI 349

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 71/372 (19%)
gur-3NP_509743.2 7tm_7 46..425 CDD:285581 64/335 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.