DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr8a and Gr22d

DIOPT Version :8

Sequence 1:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001259882.1 Gene:Gr22d / 14462661 FlyBaseID:FBgn0045498 Length:387 Species:Drosophila melanogaster

Alignment Length:395 Identity:89/396 (22%)
Similarity:154/396 (39%) Gaps:98/396 (25%)


  Fly    32 PARTRRRLMAWSLF--LLISLSALVLACLFSGE--EFLYRGDMFGCANDALKYVFAEL----GVL 88
            |.:.|.|...|.:.  ::||.|.|:|....|.|  |.....|:|  ..:||.|..:.|    ||:
  Fly    36 PKKRRLRRSMWLILFGVVISSSLLILMVKQSAEDREHGIMLDVF--QRNALLYQISSLMGVVGVV 98

  Fly    89 AI---YLETLSSQRHLANFWWLHFKLGGQKTGLVSLRSEFQQFCRYLI----FLYAMMAAEVAIH 146
            :|   :|.||...:||...:          .||:.|.:::  ||...:    |...::...|.|.
  Fly    99 SICTVHLRTLWRSKHLEEIY----------NGLMLLEAKY--FCSNAVECPAFDGYVIQKGVVIV 151

  Fly   147 LGLWQFQALTQHMLLFWSTYEPLVWLTYLRNLQFVLHLELLREQLTGLEREMGLLAEYSRFASET 211
            :||     |...|:.|......|..|..|     |:.:..|...|..|...:|::..| ||....
  Fly   152 VGL-----LAPWMVHFGMPDSKLPVLNVL-----VVSMVKLGTLLLALHYHLGVVIIY-RFVWLI 205

  Fly   212 GR-----------SFPGFES---FLRRRLVQKQRIYSHVYDMLKCFQGAFNFSILAVLLTINIRI 262
            .|           :..|..|   ||.:...:...:||.:.|...|    ....::|:.|..||  
  Fly   206 NRELLSLVCSLRGNHKGSSSRVRFLLKLYNKLVNLYSKLADCYDC----QTVLMMAIFLAANI-- 264

  Fly   263 AVDCYFMY-------------------YSIYNNVINNDYYLIVPA--LLEIPAFIYASQSCMVVV 306
             :.|::|.                   .:|.||.:  |::|.:..  ||:..    ..|:.|:: 
  Fly   265 -IVCFYMIVYRISLSKMSFFVMLIMFPLAIANNFM--DFWLSMKVCDLLQKT----GRQTSMIL- 321

  Fly   307 PRIAHQLHNIVTDSGCCSCPDLSLQIQNFSLQLLHQPIRIDCLGLTILDCSLLTRMACSVGTYMI 371
             ::.:.:.|:  |.      ||.:.|.:|:|...|:..:....||..::..:..:|..:...|::
  Fly   322 -KLFNDIENM--DK------DLEISISDFALYCSHRRFKFLHCGLFHVNREMGFKMFVASVLYLL 377

  Fly   372 YSIQF 376
            |.:||
  Fly   378 YLVQF 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 88/394 (22%)
Gr22dNP_001259882.1 7tm_7 17..386 CDD:285581 89/396 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.