DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr8a and Gr98c

DIOPT Version :8

Sequence 1:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_524531.2 Gene:Gr98c / 117336 FlyBaseID:FBgn0046886 Length:408 Species:Drosophila melanogaster

Alignment Length:452 Identity:90/453 (20%)
Similarity:148/453 (33%) Gaps:140/453 (31%)


  Fly     1 MSGHLGRVLQFHLRLYQVLGFHGLPLPGD--GNPARTRRR---LMAWSLFLLISLSALVLACL-- 58
            |.....|:|.......|||...||..|.:  ....|.|||   :..:||:|:    |::|...  
  Fly     3 MEAKRSRLLTTARPYLQVLSLFGLTPPAEFFTRTLRKRRRFCWMAGYSLYLI----AILLMVFYE 63

  Fly    59 --------------FSGEEF---LYRGDMF------GC--ANDALKY-----VFAELGVLAIYLE 93
                          |..|:|   :.|...|      .|  .|..|.|     ::.|:..|.:.::
  Fly    64 FHANIVSLHLEIYKFHVEDFSKVMGRTQKFLIVAIATCNQLNILLNYGRLGLIYDEIANLDLGID 128

  Fly    94 TLSSQRHLANFWWLHFKLGGQKTGLVSLRSEFQQFCRYLIFLYAMMAAEVAIHLGL--------W 150
            ..|......:.||                 .|:......|.|:.::...|...|.|        |
  Fly   129 KSSKNFCGKSHWW-----------------SFRLRLTLSIGLWMVIIIGVIPRLTLGRAGPFFHW 176

  Fly   151 QFQALTQHMLLFWSTYEPLVWLTYLRNLQFVLH----LELLREQL-------------TGLEREM 198
            ..|.|||.:|:......|...|..|...:.:|.    ||.|::.|             ..|::..
  Fly   177 VNQVLTQIILIMLQLKGPEYCLFVLLVYELILRTRHVLEQLKDDLEDFDCGARIQELCVTLKQNQ 241

  Fly   199 GLLAEYSRFASETGRSFPGFESFLRRRLVQKQRIYSHVYDMLKCFQGAFNFSILAVLLTINIRIA 263
            .|:....|...|.|..|....:.|                        |.::.|.:|..:|    
  Fly   242 LLIGRIWRLVDEIGAYFRWSMTLL------------------------FLYNGLTILHVVN---- 278

  Fly   264 VDCYFMYYSIYNNVINND----------YYLIVPALLEIPAFIYASQSCMVVVPRIAHQLHNIVT 318
                   ::|..::..||          .:|....||.    .:.|:.|:.....|::.||.|  
  Fly   279 -------WAIIRSIDPNDCCQLNRLGSITFLSFNLLLT----CFFSECCVKTYNSISYILHQI-- 330

  Fly   319 DSGCCSCPD----LSLQIQNFSLQLLHQPIRIDCLGLTILDCSLLTRMACSVGTYMIYSIQF 376
              ||....:    |.:.::.:.||:.|..:...|.||..::..|...|..::..|:|..:||
  Fly   331 --GCLPTAEEFQMLKMGLKEYILQMQHLKLLFTCGGLFDINIKLFGGMLVTLCGYVIIIVQF 390

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 87/443 (20%)
Gr98cNP_524531.2 7tm_7 15..393 CDD:285581 87/441 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.