DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15369 and AT5G47550

DIOPT Version :8

Sequence 1:NP_001285041.1 Gene:CG15369 / 31862 FlyBaseID:FBgn0030105 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_199566.1 Gene:AT5G47550 / 834805 AraportID:AT5G47550 Length:122 Species:Arabidopsis thaliana

Alignment Length:114 Identity:23/115 (20%)
Similarity:43/115 (37%) Gaps:28/115 (24%)


  Fly     4 AKILILCTACVLVSATPFGLGA---------------PKVLEGEDLASAQ--QTLEASLTKLAAG 51
            :|::.|....::|...|....|               |:|:|..:.|.::  :..|:.|      
plant     3 SKVVFLLLLSLVVVLLPLYASAAARVGGWSPISNVTDPQVVEIGEFAVSEYNKRSESGL------ 61

  Fly    52 EGPHYRLSKILSATSQVVSGFKNDYSVELIDNQGATKVCQVDIWSQSWL 100
                 :...::|..:|||||......|...|..|.:|.....:|.:.|:
plant    62 -----KFETVVSGETQVVSGTNYRLKVAANDGDGVSKNYLAIVWDKPWM 105

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15369NP_001285041.1 CY 24..110 CDD:238002 19/95 (20%)
AT5G47550NP_199566.1 SQAPI 34..103 CDD:293450 17/80 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1565344at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.