DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15369 and Cyss

DIOPT Version :9

Sequence 1:NP_001285041.1 Gene:CG15369 / 31862 FlyBaseID:FBgn0030105 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_941958.1 Gene:Cyss / 296234 RGDID:735160 Length:141 Species:Rattus norvegicus


Alignment Length:96 Identity:23/96 - (23%)
Similarity:39/96 - (40%) Gaps:31/96 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EASLTKLAAGEGPHY---------------RLSKILSATSQVVSGFKNDYSVELIDNQGATKVCQ 91
            ::|:.:..|.|..:|               |:.::.....|||:|.|..:.|.|    |.| :| 
  Rat    36 KSSMEEEGASEALNYAVNEYNEKNSDLYLSRVVEVKDVQKQVVAGTKFFFDVIL----GKT-IC- 94

  Fly    92 VDIWSQSWLPNGIQVTFRCP-NEPELVRKHD 121
              :.:|..|.|       || ||....::|:
  Rat    95 --LKTQGDLTN-------CPLNEEADQQEHE 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15369NP_001285041.1 CY 24..110 CDD:238002 18/82 (22%)
CyssNP_941958.1 CY 31..139 CDD:214484 23/96 (24%)
Secondary area of contact 76..80 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565344at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.