DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wsck and htl

DIOPT Version :10

Sequence 1:NP_733018.1 Gene:Wsck / 318600 FlyBaseID:FBgn0046685 Length:791 Species:Drosophila melanogaster
Sequence 2:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster


Alignment Length:166 Identity:35/166 - (21%)
Similarity:60/166 - (36%) Gaps:55/166 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 GGYVLLNSCRFFVLDEADGLLKQGYTEMIDRLHKQIPKITSDGRRLQMVV----CSATL-----H 412
            |||::.|   |.:|.||..|.|           .::..::.:|..:.|.|    .|.||     |
  Fly   183 GGYMVTN---FVILTEAFELPK-----------SRLLVVSLNGWSVSMAVTALAASYTLNWYAYH 233

  Fly   413 S-FEVKKMAERLMHFPT------WVDLKGEDAVPETVHHVVCMVDPQKDI--------SWQ---- 458
            : |.:......::...|      |:...|.....:.:...:.:::..:||        ||.    
  Fly   234 TIFAIVGACIAIISLATCSESCRWLSANGLQNDAKKIALQITLLNNNRDIEEDDISILSWHEILG 298

  Fly   459 -SMRTHIQTDGVHARDNVRPGSNTAETLSEAVKMLK 493
             |..||  ||          ...|.:||.::.:.||
  Fly   299 FSAPTH--TD----------EKKTWKTLFKSTRFLK 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WsckNP_733018.1 WSC 42..115 CDD:460348
fn3 130..222 CDD:394996
PTKc 497..750 CDD:270623
htlNP_524394.2 Ig 101..191 CDD:472250 4/10 (40%)
Ig strand B 121..125 CDD:409353
Ig strand C 134..138 CDD:409353
Ig strand E 157..161 CDD:409353
Ig strand F 171..176 CDD:409353
Ig strand G 184..187 CDD:409353 2/2 (100%)
Ig 200..289 CDD:472250 14/99 (14%)
Ig strand B 216..220 CDD:409353 2/3 (67%)
Ig strand C 229..233 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 1/3 (33%)
Ig strand F 269..274 CDD:409353 0/4 (0%)
Ig strand G 282..285 CDD:409353 2/2 (100%)
Protein Kinases, catalytic domain 404..692 CDD:473864
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.