DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp8a and Obp99a

DIOPT Version :10

Sequence 1:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_651707.1 Gene:Obp99a / 43488 FlyBaseID:FBgn0039678 Length:142 Species:Drosophila melanogaster


Alignment Length:106 Identity:26/106 - (24%)
Similarity:51/106 - (48%) Gaps:6/106 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LLRARDQCGRELTAAQRL--QLDRMQFEDAAHVRHYLHCFWSRLQLWLDETGFQAQRIVQSFGGE 102
            :|..||:|.:||.....|  :..:.::.:.|..:.|:.|.:::..|:..::||..:.|.|...|.
  Fly    26 MLAYRDECVKELAVPVDLVEKYQKWEYPNDAKTQCYIKCVFTKWGLFDVQSGFNVENIHQQLVGN 90

  Fly   103 RRLNVEQALPAINGCNAKTSSRGSGAQTVVDWCFRAFVCVL 143
            ...:.|....::..|..| :.:||.|   .:|.:|...|:|
  Fly    91 HADHNEAFHASLAACVDK-NEQGSNA---CEWAYRGATCLL 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 25/103 (24%)
Obp99aNP_651707.1 PhBP 29..130 CDD:214783 25/103 (24%)

Return to query results.
Submit another query.