DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp8a and Obp99a

DIOPT Version :9

Sequence 1:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_001287586.1 Gene:Obp99a / 43488 FlyBaseID:FBgn0039678 Length:142 Species:Drosophila melanogaster

Alignment Length:106 Identity:26/106 - (24%)
Similarity:51/106 - (48%) Gaps:6/106 - (5%)


  Fly    40 LLRARDQCGRELTAAQRL--QLDRMQFEDAAHVRHYLHCFWSRLQLWLDETGFQAQRIVQSFGGE 102
            :|..||:|.:||.....|  :..:.::.:.|..:.|:.|.:::..|:..::||..:.|.|...|.
  Fly    26 MLAYRDECVKELAVPVDLVEKYQKWEYPNDAKTQCYIKCVFTKWGLFDVQSGFNVENIHQQLVGN 90

  Fly   103 RRLNVEQALPAINGCNAKTSSRGSGAQTVVDWCFRAFVCVL 143
            ...:.|....::..|..| :.:||.|   .:|.:|...|:|
  Fly    91 HADHNEAFHASLAACVDK-NEQGSNA---CEWAYRGATCLL 127

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 25/103 (24%)
Obp99aNP_001287586.1 PhBP 29..130 CDD:214783 25/103 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450219
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.