DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp8a and Obp83b

DIOPT Version :8

Sequence 1:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_524242.2 Gene:Obp83b / 40738 FlyBaseID:FBgn0010403 Length:141 Species:Drosophila melanogaster

Alignment Length:126 Identity:26/127 (20%)
Similarity:47/127 (37%) Gaps:42/127 (33%)


  Fly    14 LLLLLV-----------VELTPPAIPVPMRSSPQSLALLR-----------ARDQCGRELTAAQR 56
            |:|||:           .|..||||          |.|.:           ..|:..:|.:    
  Fly     6 LILLLIGCAAAQEPRRDGEWPPPAI----------LKLGKHFHDICAPKTGVTDEAIKEFS---- 56

  Fly    57 LQLDRMQFEDAAHVRHYLHCFWSRLQLWLDETGFQAQRIVQSFGGERRLNVEQALPAINGC 117
               |....||.| ::.|::|.:...::..|......::::.:..||:..|:  .:.|..||
  Fly    57 ---DGQIHEDEA-LKCYMNCLFHEFEVVDDNGDVHMEKVLNAIPGEKLRNI--MMEASKGC 111

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 15/76 (20%)
Obp83bNP_524242.2 PBP_GOBP 28..133 CDD:279703 20/105 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124145260
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11857
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.