DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp8a and Obp83b

DIOPT Version :10

Sequence 1:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_524242.2 Gene:Obp83b / 40738 FlyBaseID:FBgn0010403 Length:141 Species:Drosophila melanogaster


Alignment Length:126 Identity:26/126 - (20%)
Similarity:47/126 - (37%) Gaps:42/126 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLLLV-----------VELTPPAIPVPMRSSPQSLALLR-----------ARDQCGRELTAAQR 56
            |:|||:           .|..||||          |.|.:           ..|:..:|.:    
  Fly     6 LILLLIGCAAAQEPRRDGEWPPPAI----------LKLGKHFHDICAPKTGVTDEAIKEFS---- 56

  Fly    57 LQLDRMQFEDAAHVRHYLHCFWSRLQLWLDETGFQAQRIVQSFGGERRLNVEQALPAINGC 117
               |....||.| ::.|::|.:...::..|......::::.:..||:..|:  .:.|..||
  Fly    57 ---DGQIHEDEA-LKCYMNCLFHEFEVVDDNGDVHMEKVLNAIPGEKLRNI--MMEASKGC 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 15/75 (20%)
Obp83bNP_524242.2 PBP_GOBP 28..133 CDD:460193 20/104 (19%)

Return to query results.
Submit another query.