DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp8a and Obp83a

DIOPT Version :10

Sequence 1:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_001287190.1 Gene:Obp83a / 40737 FlyBaseID:FBgn0011281 Length:174 Species:Drosophila melanogaster


Alignment Length:92 Identity:21/92 - (22%)
Similarity:40/92 - (43%) Gaps:6/92 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RRSQIGLLSRLLLLLLVVELTPPAIPVPMRSSPQSLALLRAR---DQCGRE--LTAAQRLQLDRM 62
            ||....:|...|.||....:.|||......:.|....|..|:   |.|..:  :|.|...:....
  Fly    28 RRVSASVLLIALSLLSGALILPPAAAQRDENYPPPGILKMAKPFHDACVEKTGVTEAAIKEFSDG 92

  Fly    63 QFEDAAHVRHYLHCFWSRLQLWLDETG 89
            :..:...::.|::||:..::: :|:.|
  Fly    93 EIHEDEKLKCYMNCFFHEIEV-VDDNG 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 10/52 (19%)
Obp83aNP_001287190.1 PhBP 71..167 CDD:214783 9/49 (18%)

Return to query results.
Submit another query.