powered by:
                   
 
    
    
             
          
            Protein Alignment Obp8a and Obp83a
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_727322.1 | Gene: | Obp8a / 31860 | FlyBaseID: | FBgn0030103 | Length: | 163 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_001287190.1 | Gene: | Obp83a / 40737 | FlyBaseID: | FBgn0011281 | Length: | 174 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 92 | Identity: | 21/92 - (22%) | 
          
            | Similarity: | 40/92 -  (43%) | Gaps: | 6/92 - (6%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly     3 RRSQIGLLSRLLLLLLVVELTPPAIPVPMRSSPQSLALLRAR---DQCGRE--LTAAQRLQLDRM 62||....:|...|.||....:.|||......:.|....|..|:   |.|..:  :|.|...:....
 Fly    28 RRVSASVLLIALSLLSGALILPPAAAQRDENYPPPGILKMAKPFHDACVEKTGVTEAAIKEFSDG 92
 
 
  Fly    63 QFEDAAHVRHYLHCFWSRLQLWLDETG 89:..:...::.|::||:..::: :|:.|
 Fly    93 EIHEDEKLKCYMNCFFHEIEV-VDDNG 118
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 1 | 0.930 | - | - |  | C45452904 | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | P | PTHR11857 | 
          
            | Phylome | 0 | 0.000 | Not matched by this tool. | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 2 | 2.030 |  | 
        
      
           
             Return to query results.
             Submit another query.