DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp8a and Obp56a

DIOPT Version :8

Sequence 1:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_611442.1 Gene:Obp56a / 37264 FlyBaseID:FBgn0034468 Length:139 Species:Drosophila melanogaster

Alignment Length:103 Identity:23/103 - (22%)
Similarity:48/103 - (46%) Gaps:14/103 - (13%)


  Fly    44 RDQCGRE--LTAAQRLQLDRMQFED-AAHVRHYLHCFWSRLQLWLDETGFQAQRIVQSFG---GE 102
            |:||..|  ||..::.:::...|.: ..:::.:.:||:.::.. |.:...|...:::..|   ||
  Fly    36 REQCAEEVKLTEEEKAKVNAKDFNNPTENIKCFANCFFEKVGT-LKDGELQESVVLEKLGALIGE 99

  Fly   103 RRLNVEQALPAINGCNA-KTSSRGSGAQTVVDWCFRAF 139
                 |:...|:..|.. |..::...|..:.| ||.:|
  Fly   100 -----EKTKAALEKCRTIKGENKCDTASKLYD-CFESF 131

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 23/103 (22%)
Obp56aNP_611442.1 PBP_GOBP 24..128 CDD:279703 20/98 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11857
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.