DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp8a and Obp57e

DIOPT Version :10

Sequence 1:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_611488.1 Gene:Obp57e / 326110 FlyBaseID:FBgn0050145 Length:136 Species:Drosophila melanogaster


Alignment Length:49 Identity:12/49 - (24%)
Similarity:16/49 - (32%) Gaps:13/49 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 NVEQALPAINGCNAKTS-SRGSGAQTVVDW----------CFRAFVCVL 143
            ||.......|.|.::.. |.....|.:.:|          ||  ..|||
  Fly    17 NVLANTSVFNPCVSQNELSEYEAHQVMENWPVPPIDRAYKCF--LTCVL 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 12/49 (24%)
Obp57eNP_611488.1 PhBP 28..123 CDD:214783 9/38 (24%)

Return to query results.
Submit another query.