DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp8a and Obp56i

DIOPT Version :10

Sequence 1:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_725929.1 Gene:Obp56i / 246667 FlyBaseID:FBgn0043532 Length:140 Species:Drosophila melanogaster


Alignment Length:157 Identity:36/157 - (22%)
Similarity:55/157 - (35%) Gaps:43/157 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLLLVVELTPPAIPV-PMRSSPQSLALLRARDQCGRELTAAQRLQLDRMQFEDAAH-VRHYLHCF 77
            |||:||.|....:.. |::....:.|.:.|:|...|..|            :|..| |:.:..||
  Fly     9 LLLVVVTLPTCFVQAGPIKDQCMAAAGITAQDVANRHET------------DDPGHSVKCFFRCF 61

  Fly    78 WSRLQLWLDETGFQAQRIVQSFGGERRLN-------VEQALPAINGCNAKTSSRGSGAQTVVDWC 135
                   |:..|..|...:.....:|.|.       ||:.....|...::||...|         
  Fly    62 -------LENIGIIADNQIIPGAFDRVLGHIVTAEAVERMEATCNMIKSETSHDES--------- 110

  Fly   136 FRAFVCVLATPVGEWYKR-HMSDVING 161
                 |..|..:.|.|:. .:|||..|
  Fly   111 -----CEFAWQISECYEGVRLSDVKKG 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 21/108 (19%)
Obp56iNP_725929.1 PBP_GOBP 25..121 CDD:460193 25/128 (20%)

Return to query results.
Submit another query.