DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp8a and Obp56c

DIOPT Version :10

Sequence 1:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_995902.1 Gene:Obp56c / 170882 FlyBaseID:FBgn0046879 Length:245 Species:Drosophila melanogaster


Alignment Length:139 Identity:32/139 - (23%)
Similarity:47/139 - (33%) Gaps:57/139 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SRLLLLLLVVELTPPAIPVPMRSSPQSLA--LLRARDQCGR--ELTAAQRLQL------------ 59
            :|.|.:.|.:.:|...:|.|...:...|:  :|||   |.|  |::.:| |:|            
  Fly    34 TRSLSVSLNMSMTRTLVPDPPNGTENKLSQEMLRA---CMRRTEISMSQ-LKLFHMSLMNSDYNN 94

  Fly    60 --------------------------DRMQFEDAAHVRHYLHCFWSRLQLWLD--------ETGF 90
                                      .:|.:.|..| ...|.||.|.|...||        |..|
  Fly    95 DNDIAPTPVQSIGDVNNLGDLDFNGNSQMPYLDLKH-NEPLQCFVSCLYETLDLDRYNVLLEEAF 158

  Fly    91 --QAQRIVQ 97
              |.|.|:|
  Fly   159 KNQVQTIIQ 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 23/105 (22%)
Obp56cNP_995902.1 PBP_GOBP <131..195 CDD:467938 13/37 (35%)

Return to query results.
Submit another query.