DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp8a and Obp56c

DIOPT Version :9

Sequence 1:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_995902.1 Gene:Obp56c / 170882 FlyBaseID:FBgn0046879 Length:245 Species:Drosophila melanogaster


Alignment Length:139 Identity:32/139 - (23%)
Similarity:47/139 - (33%) Gaps:57/139 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SRLLLLLLVVELTPPAIPVPMRSSPQSLA--LLRARDQCGR--ELTAAQRLQL------------ 59
            :|.|.:.|.:.:|...:|.|...:...|:  :|||   |.|  |::.:| |:|            
  Fly    34 TRSLSVSLNMSMTRTLVPDPPNGTENKLSQEMLRA---CMRRTEISMSQ-LKLFHMSLMNSDYNN 94

  Fly    60 --------------------------DRMQFEDAAHVRHYLHCFWSRLQLWLD--------ETGF 90
                                      .:|.:.|..| ...|.||.|.|...||        |..|
  Fly    95 DNDIAPTPVQSIGDVNNLGDLDFNGNSQMPYLDLKH-NEPLQCFVSCLYETLDLDRYNVLLEEAF 158

  Fly    91 --QAQRIVQ 97
              |.|.|:|
  Fly   159 KNQVQTIIQ 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 23/105 (22%)
Obp56cNP_995902.1 PBP_GOBP <125..195 CDD:279703 15/44 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.