DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31076 and LRMDA

Sequence 1:NP_733184.2 Gene:CG31076 FlyBaseID:FBgn0051076 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001292510.1 Gene:LRMDA HGNCID:23405 Length:226 Species:Homo sapiens

Alignment Length:161 Identity:55/162 (34%)
Similarity:83/162 (51%) Gaps:14/162 (9%)


  Fly     9 SQLILVQQNLRTLPQELVKKHADHVEQLDLSHNCLKDLSWLADFEQLRHLVLDSNRMHEAHLRTL 73
            :|:..:.|:.|.:|:.|.:......::||||.|.|:.|..|:.|..|..|:||:|::.:    .|
Human     9 TQVSYIGQDCREIPEHLGRDCGHFAKRLDLSFNLLRSLEGLSAFRSLEELILDNNQLGD----DL 69

  Fly    74 TCP-LPQLEVLMLNKNEFSDLPTTMRLIRKFFPNLQYLSLHGNPICPD---GLELQPFSTYLRYD 134
            ..| ||:|..|.||||..:||...:..:.:..|.|:||||.||..||:   .||..      ..|
Human    70 VLPGLPRLHTLTLNKNRITDLENLLDHLAEVTPALEYLSLLGNVACPNELVSLEKD------EED 128

  Fly   135 YEYYSNYIAQSLSKLKFLDHGLVQRTYKYES 165
            |:.|..::...|..|||||...|.|..:.|:
Human   129 YKRYRCFVLYKLPNLKFLDAQKVTRQEREEA 159

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31076NP_733184.2 LRR_8 11..65 CDD:290566 18/54 (33%)
leucine-rich repeat 11..32 CDD:275378 4/21 (19%)
leucine-rich repeat 33..54 CDD:275378 9/21 (43%)
leucine-rich repeat 55..79 CDD:275378 9/25 (36%)
leucine-rich repeat 80..106 CDD:275378 9/26 (35%)
LRMDANP_001292510.1 LRR_RI <27..>113 CDD:238064 34/90 (38%)
leucine-rich repeat 34..54 CDD:275378 9/20 (45%)
LRR_8 53..112 CDD:290566 24/63 (38%)
LRR_4 54..93 CDD:289563 17/43 (40%)
leucine-rich repeat 55..76 CDD:275378 9/25 (36%)
leucine-rich repeat 77..103 CDD:275378 9/26 (35%)
leucine-rich repeat 104..142 CDD:275378 15/44 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C31651122
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I5289
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1133053at2759
OrthoFinder 1 1.000 FOG0007594
OrthoInspector 1 1.000 T609306
orthoMCL 1 0.900 OOG5_134976
Panther 1 1.100 LDO PTHR46282
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5168
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.