powered by:
                  
 
    
 
    
             
          
            Protein Alignment CG31076 and CG6661
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_733184.2 | 
            Gene: | CG31076 / 318582 | 
            FlyBaseID: | FBgn0051076 | 
            Length: | 182 | 
            Species: | Drosophila melanogaster | 
          
          
            | Sequence 2: | NP_648686.3 | 
            Gene: | CG6661 / 39556 | 
            FlyBaseID: | FBgn0036403 | 
            Length: | 581 | 
            Species: | Drosophila melanogaster | 
          
        
        
        
          
            | Alignment Length: | 189 | 
            Identity: | 35/189 - (18%) | 
          
          
            | Similarity: | 61/189 -  (32%) | 
            Gaps: | 75/189 - (39%) | 
          
        
      
- Green bases have known domain annotations that are detailed below.
      | 
 
  Fly    16 QNLRTLPQELVKKHADHVEQLDLSHNCLKDLSWLADFEQLRHLVL-DSNRMHEAHLRTL------ 73 
            :::|.|...| :.:||::|.|                .:||..:. |.|.....|||.:       
  Fly   180 RDIRRLLTSL-RANADYLEHL----------------SELRFEIQGDMNVFPSFHLRPMDGFVAA 227 
 
  Fly    74 --------------TCPL---------PQLEV-----LMLNKNEFSDLPTTMRLIRKFFPNLQ-- 108 
                          .||.         |.|||     |:....:.:.||:.   :..|.|..:   
  Fly   228 LAPFESVALSSSLALCPALMGNTVLWNPSLEVAPVSYLIFRAFQEAGLPSG---VINFVPANERL 289 
 
  Fly   109 YLSLHGNPICPDGLELQPFSTYLRYDYEYYSNYIAQSLSKLKFLDHGLVQRTYKYESFP 167 
            :|....:.:...||..|..:.:.|:.::..|:                  |..:|..|| 
  Fly   290 FLDTITDAVHFAGLNTQASAAFYRHVHKLVSD------------------RMERYICFP 330 
 
       | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | 
            Simple Score | 
            Weighted Score | 
            Original Tool Information | 
          
          
            | BLAST Result | 
            Score | 
            Score Type | 
            Cluster ID | 
          
          
          
            | Compara | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Domainoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | eggNOG | 
            1 | 
            0.900 | 
            - | 
            - | 
             | 
            E1_COG1012 | 
          
          
            | Homologene | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Inparanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Isobase | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OMA | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoDB | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoFinder | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoInspector | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | orthoMCL | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Panther | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Phylome | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | RoundUp | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SonicParanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
             | 
            1 | 0.900 | 
             | 
          
        
      
           
             Return to query results.
             Submit another query.