DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31076 and ALDH1L2

Sequence 1:NP_733184.2 Gene:CG31076 FlyBaseID:FBgn0051076 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001029345.2 Gene:ALDH1L2 HGNCID:26777 Length:923 Species:Homo sapiens

Alignment Length:30 Identity:9/31 (29%)
Similarity:16/31 (52%) Gaps:3/31 (10%)


  Fly   121 GLELQPFSTYLRYDYEYYSNYIAQSLSKLK 150
            ||:||....|:...:|   .:|.:.:.||:
Human   391 GLQLQNEDVYMATKFE---GFIQKVVRKLR 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31076NP_733184.2 LRR_8 11..65 CDD:290566
leucine-rich repeat 11..32 CDD:275378
leucine-rich repeat 33..54 CDD:275378
leucine-rich repeat 55..79 CDD:275378
leucine-rich repeat 80..106 CDD:275378
ALDH1L2NP_001029345.2 Fmt 22..326 CDD:223301
FMT_core_FDH_N 23..225 CDD:187716
GART 23..225
FDH_Hydrolase_C 228..327 CDD:187731
PP-binding 346..>390 CDD:278949
Aldehyde dehydrogenase 438..923
ALDH_F1L_FTFDH 439..923 CDD:143458
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.