DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31076 and aldh3b2

Sequence 1:NP_733184.2 Gene:CG31076 FlyBaseID:FBgn0051076 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001120622.1 Gene:aldh3b2 XenbaseID:XB-GENE-5776192 Length:469 Species:Xenopus tropicalis

Alignment Length:34 Identity:11/35 (31%)
Similarity:20/35 (57%) Gaps:2/35 (6%)


  Fly    16 QNLRTLPQELVKKHADHV-EQLDLSHNCLKDLSW 48
            ::|..:..||..|:..:| |:.|:| |..:.:||
 Frog   202 KHLTPVTLELGGKNPCYVDEECDIS-NAARRISW 234

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31076NP_733184.2 LRR_8 11..65 CDD:290566 11/35 (31%)
leucine-rich repeat 11..32 CDD:275378 4/16 (25%)
leucine-rich repeat 33..54 CDD:275378 7/18 (39%)
leucine-rich repeat 55..79 CDD:275378
leucine-rich repeat 80..106 CDD:275378
aldh3b2NP_001120622.1 ALDH_F3AB 5..447 CDD:143450 11/35 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.