DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spn-D and XRCC3

Sequence 1:NP_733200.1 Gene:spn-D FlyBaseID:FBgn0003482 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001093588.1 Gene:XRCC3 HGNCID:12830 Length:346 Species:Homo sapiens

Alignment Length:280 Identity:80/281 (28%)
Similarity:116/281 (41%) Gaps:57/281 (20%)


  Fly    36 WDISQSAS-----NKILT--------------------GKKALDTHFGGGISLGHLVELIGNSGT 75
            |.:.::||     :.|||                    |...||....||:.|..:.||.|.|..
Human    47 WHLLRTASLHLRGSSILTALQLHQQKERFPTQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSA 111

  Fly    76 GKTQMCLQLCLNVQIPKAAGGLEGSALFIDTRQDFHPDRLMGLALKLERQYAHRVPEFKAHKMLQ 140
            ||||:.|||||.||.|:..||||..|::|.|...|...||..|..:..|.... ||    .::||
Human   112 GKTQLALQLCLAVQFPRQHGGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTD-VP----GELLQ 171

  Fly   141 KIHYVRCPKLDQL--MATVLSCHRH----LVDHPDIKLIVIDSLAFTLRMLED---GAHRYEMLL 196
            |:.:.....::.:  :.|:|.|...    |:.....:|:||||:|...|...|   .|.|...|.
Human   172 KLRFGSQIFIEHVADVDTLLECVNKKVPVLLSRGMARLVVIDSVAAPFRCEFDSQASAPRARHLQ 236

  Fly   197 ELHESMRRLQRQHELTWVFTNVLTHRYVKQ----------KFQVEPALG-----DLHSHLINERI 246
            .|..::|.|....:...:..|.:|....:|          ..:|.||||     .|...|:.:|:
Human   237 SLGATLRELSSAFQSPVLCINQVTEAMEEQGAAHGPLGFWDERVSPALGITWANQLLVRLLADRL 301

  Fly   247 WFSGSSELHLGKSWRTSRLI 266
               ...|..||...||.|::
Human   302 ---REEEAALGCPARTLRVL 318

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spn-DNP_733200.1 P-loop_NTPase 46..249 CDD:304359 71/247 (29%)
XRCC3NP_001093588.1 recomb_DMC1 2..337 CDD:131292 80/281 (28%)
Rad51_DMC1_radA 82..338 CDD:238543 74/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1065
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.