DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34133 and YMR102C

Sequence 1:NP_001036772.2 Gene:CG34133 FlyBaseID:FBgn0083969 Length:1108 Species:Drosophila melanogaster
Sequence 2:NP_013820.1 Gene:YMR102C SGDID:S000004708 Length:834 Species:Saccharomyces cerevisiae

Alignment Length:692 Identity:179/693 (26%)
Similarity:272/693 (39%) Gaps:206/693 (30%)


  Fly   585 TSHLEVIQKESDEESVIGIPPSIEGQQPDEEELETEDGSRLKKKTARIK----------RFFGST 639
            ||..:|..:.|:..:..|   |.|..:..:|..:.|..|...|..:::.          :|..:.
Yeast     9 TSISKVHSEFSNSSNTTG---SEEESRSHQESFDGESSSGESKSKSKLNLEYSADIEPLKFRMTK 70

  Fly   640 MRKTVDKAK----SIASEVSHARHKEDVA-----------------DIVDAMNPEQNIK----IK 679
            ...|.||.|    ..|:: |..|.||.:.                 :.:|....|..::    ||
Yeast    71 TNNTNDKLKYSNNGNATD-SFMRLKEHLQRGNTLNSNLRVNEFYPFNSIDTEQFENYLREPKYIK 134

  Fly   680 ASSSNKGPYEFTKLQHVQDL-------------SGEDTS-AVWCMKFSSCGRLLATAGQDKVLRI 730
            .....|...:|.:|...|:|             |.|.|| |:|..|||..|:.:||..:|..:||
Yeast   135 MLKRRKNLKQFRRLFLAQELMAYEGETVTSTSKSSEPTSKAIWSTKFSRDGKFMATGSKDGKIRI 199

  Fly   731 WVL-----------------KDAYPFFQDMRNKYNADQKSSPTPSQ--ESLVSQHSAEEAIAMAT 776
            |.:                 |:|..  :.||.|......::|...|  :|...::..:|.:....
Yeast   200 WKVIGSPVERAELDSSAESNKEARA--KSMRIKQQVSSLNNPKEKQFLDSATEKYEEKEKLLNLY 262

  Fly   777 AAEKCTGPFMPKPFCTYNGHTSDLLDVSWSKNYFILSSSMDKTVRLWHISRKECLCCFQHIDFVT 841
            |.     .|.|.|...|..|..|:||::||||.||||:||||||:|||..||..|..|.|.||||
Yeast   263 AP-----VFHPTPLRLYKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVT 322

  Fly   842 AIAFHPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFC-QNGQFAVVGSYDGR 905
            .:.|||.|||:|:||.||.|.|||:|.|.:|:.  |.|.| .|||:.... :.|::.::|:::|.
Yeast   323 CVEFHPTDDRFFISGCLDHKCRLWSILDDEVSF--EYDCQ-DLITSVTLSPEEGKYTIIGTFNGY 384

  Fly   906 CIFYNTDQLKYHTQIHV--RSTRGKN------------RIGRKISGIE----PMPGEDKILVTSN 952
            .....|..|...:..||  |.|:.:|            |.|.:::|::    .:....:::||||
Yeast   385 VHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKIRHGPRVTGLQAFRSQLDNSFRLVVTSN 449

  Fly   953 DSRVRLYDLRDLNLSCKYKGYLNVSSQIKGSFS--HDGKYIIAGSENQCIYIWKTN--------- 1006
            |||:|::||....|....||:.:.|||.|...|  |....::..|::..:|.|:..         
Yeast   450 DSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSIWHGQPIVVNSSDDHWVYGWRLKSSDRENDQD 514

  Fly  1007 -----------------------------------HDYSKLSSV------RRD---RSDFWEGIK 1027
                                               |.:.||:::      ..|   ::..:....
Yeast   515 EPKRKPKGLARSGSLRSIFSKSMSRSSSQNNEEKPHHHLKLTNLLPLPHHSNDHYIKNTDYISFH 579

  Fly  1028 AHNATVTCAIFAPHPEA---------II-----------------------------------KP 1048
            ||||.|||...|| ||.         :|                                   ..
Yeast   580 AHNAPVTCVSIAP-PETSKTLSLSNDVICELSLEFFQTSDSFDVLSRSNDDGIMSDVESSLGYNS 643

  Fly  1049 EPDEISNEKLAHNQPDPLVEQHKKGCGYVLVSADFNGAIKVF 1090
            :|..|||.......||.:     ...|.:|:|.|..|.|:||
Yeast   644 KPGSISNASATSAIPDVV-----DAIGTILISTDNVGTIRVF 680

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34133NP_001036772.2 WD40 repeat 663..700 CDD:293791 9/71 (13%)
WD40 704..1101 CDD:225201 147/526 (28%)
WD40 704..1046 CDD:295369 132/445 (30%)
WD40 repeat 707..765 CDD:293791 19/77 (25%)
WD40 repeat 800..834 CDD:293791 22/34 (65%)
WD40 repeat 841..878 CDD:293791 20/37 (54%)
WD40 repeat 885..920 CDD:293791 7/36 (19%)
WD40 repeat 935..975 CDD:293791 14/44 (32%)
WD40 repeat 978..1003 CDD:293791 7/27 (26%)
WD40 repeat 1034..1069 CDD:293791 13/79 (16%)
YMR102CNP_013820.1 WD40 166..>507 CDD:225201 119/351 (34%)
WD40 173..506 CDD:295369 116/343 (34%)
WD40 repeat 176..221 CDD:293791 12/45 (27%)
WD40 repeat 234..276 CDD:293791 9/47 (19%)
WD40 repeat 281..315 CDD:293791 22/34 (65%)
WD40 repeat 322..358 CDD:293791 20/38 (53%)
WD40 repeat 363..400 CDD:293791 7/37 (19%)
WD40 repeat 430..472 CDD:293791 14/42 (33%)
WD40 repeat 480..502 CDD:293791 4/22 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C330126343
eggNOG 1 0.900 E1_KOG0283
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002807
OrthoInspector 1 1.000 T634684
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14221
Phylome 1 0.910 0.875 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1821
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.