DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34133 and DGR2

Sequence 1:NP_001036772.2 Gene:CG34133 FlyBaseID:FBgn0083969 Length:1108 Species:Drosophila melanogaster
Sequence 2:NP_012801.1 Gene:DGR2 SGDID:S000001604 Length:852 Species:Saccharomyces cerevisiae

Alignment Length:618 Identity:145/619 (23%)
Similarity:254/619 (41%) Gaps:168/619 (27%)


  Fly   636 FGSTMRKTVDKAKSIASEVSHARHKED--VADIVDAMNPEQNIK----IKASSSNKGPYEFTKLQ 694
            :|:.:|||:.: .|:.|...:...:.|  ..|:.|....|..::    ||.....:|..:|.::.
Yeast    81 YGTRLRKTLHR-NSVVSNGYNKLSENDRWYFDLFDRKYFENYLEEPTYIKIFKKKEGLEQFDRMF 144

  Fly   695 HVQDLSGEDT-------------------SAVWCMKFSSCGRLLATAGQDKVLRIWVLKDAYPFF 740
            ..|:|...|.                   :::.|..||..|:.:....:|..|.:|.:.:: |. 
Yeast   145 LAQELKIPDVYKSTTYQGEPAVANSELFKNSICCCTFSHDGKYMVIGCKDGSLHLWKVINS-PV- 207

  Fly   741 QDMRNKYNADQKSSPTPSQESL--------VSQHSAEEAIAMATAAEKCTGP----------FMP 787
              .|::....:||.......||        :|.|:...:......:::..||          |..
Yeast   208 --KRSEMGRSEKSVSASRANSLKIQRHLASISSHNGSISSNDLKPSDQFEGPSKQLHLYAPVFYS 270

  Fly   788 KPFCTYNGHTSDLLDVSWSKNYFILSSSMDKTVRLWHISRKECLCCFQHIDFVTAIAFHPRDDRY 852
            ..|..:..|..|:||.:||||.|::::|||||.:|||..||..|..|.|.||||:..|.|.|||:
Yeast   271 DVFRVFMEHALDILDANWSKNGFLITASMDKTAKLWHPERKYSLKTFVHPDFVTSAIFFPNDDRF 335

  Fly   853 FLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFC-QNGQFAVVGSYDGRCIFYNTDQLKY 916
            .::|.||.:.|||:|.|.:|:...:.   ..|||:.... ..|::.::|:::|......|..||:
Yeast   336 IITGCLDHRCRLWSILDNEVSYAFDC---KDLITSLTLSPPGGEYTIIGTFNGYIYVLLTHGLKF 397

  Fly   917 HTQIHV--RSTRG--KNRI-----------GRKISGIEPMPGE-DK---ILVTSNDSRVRLYDLR 962
            .:..||  :||:|  ||..           |.:|:|::....: ||   ::||:|||:::::||.
Yeast   398 VSSFHVSDKSTQGTTKNSFHPSSEYGKVQHGPRITGLQCFFSKVDKNLRLIVTTNDSKIQIFDLN 462

  Fly   963 DLNLSCKYKGYLNVSSQIKGSF--SHDGKYIIAGSENQCIYIWK--------------------- 1004
            :......:||:.:.||:.:|.|  ..:...:..||::...|.||                     
Yeast   463 EKKPLELFKGFQSGSSRHRGQFLMMKNEPVVFTGSDDHWFYTWKMQSFNLSAEMNCTAPHRKKRL 527

  Fly  1005 ------------------------------TNHDYSKLS-SVRRDRSDFWEGIK--------AHN 1030
                                          ::|.::..| :|.:.::...:.||        |||
Yeast   528 SGSMSLKGLLRIVSNKSTNDECLTETSNQSSSHTFTNSSKNVLQTQTVGSQAIKNNHYISFHAHN 592

  Fly  1031 ATVTCAIFAPHPEAIIKPEPDEISNE---------------------KLAHNQPD-PLVE----- 1068
            :.||||..|  |:..||..  .:||:                     :...|:|: |:.|     
Yeast   593 SPVTCASIA--PDVAIKNL--SLSNDLIFELTSQYFKEMGQNYSESKETCDNKPNHPVTETGGFS 653

  Fly  1069 ----QHKKGCGYVLVSADFNGAIKVFINKTKPK 1097
                ......|.:|::.|..|.|:||.....|:
Yeast   654 SNLSNVVNNVGTILITTDSQGLIRVFRTDILPE 686

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34133NP_001036772.2 WD40 repeat 663..700 CDD:293791 9/41 (22%)
WD40 704..1101 CDD:225201 128/545 (23%)
WD40 704..1046 CDD:295369 112/461 (24%)
WD40 repeat 707..765 CDD:293791 14/66 (21%)
WD40 repeat 800..834 CDD:293791 18/34 (53%)
WD40 repeat 841..878 CDD:293791 15/37 (41%)
WD40 repeat 885..920 CDD:293791 8/36 (22%)
WD40 repeat 935..975 CDD:293791 13/44 (30%)
WD40 repeat 978..1003 CDD:293791 6/27 (22%)
WD40 repeat 1034..1069 CDD:293791 13/66 (20%)
DGR2NP_012801.1 WD40 172..519 CDD:225201 98/354 (28%)
WD40 173..506 CDD:295369 97/340 (29%)
WD40 repeat 176..238 CDD:293791 14/66 (21%)
WD40 repeat 244..278 CDD:293791 4/34 (12%)
WD40 repeat 283..317 CDD:293791 18/34 (53%)
WD40 repeat 324..360 CDD:293791 15/36 (42%)
WD40 repeat 365..414 CDD:293791 14/49 (29%)
WD40 repeat 422..476 CDD:293791 14/54 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C330120462
eggNOG 1 0.900 E1_KOG0283
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002807
OrthoInspector 1 1.000 T634684
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14221
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1821
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.