DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34133 and AT1G64610

Sequence 1:NP_001036772.2 Gene:CG34133 FlyBaseID:FBgn0083969 Length:1108 Species:Drosophila melanogaster
Sequence 2:NP_176642.1 Gene:AT1G64610 AraportID:AT1G64610 Length:647 Species:Arabidopsis thaliana

Alignment Length:676 Identity:181/677 (27%)
Similarity:312/677 (46%) Gaps:122/677 (18%)


  Fly   507 GVNDKERRKSAGDEDVLKQMNIYVRTRTSSGKQLTDFEILEQVPV--KNLDTGENMPLSEMRSPP 569
            |..:.|.|.....|.|.....:::.|.|.........:.|:.:.:  |...|.::   ||....|
plant     5 GDEEDEDRFFDAPEVVSDDFGLHLWTSTPESVSTRRRKFLQSMGLSFKKTATDDD---SEDELEP 66

  Fly   570 VPEGWNPLSLHILKLTSHLE----VIQKESDEESVIGIPPSIEGQQPDEEELETEDGSR------ 624
            .....|.:| .::.::|.::    :::.||...|...:.........|:..|...|.|.      
plant    67 SHTDSNVVS-EVVNVSSGVKEIDLLVRNESTTSSGFDVSSVSSSDTDDQTLLARNDASSSTSTMP 130

  Fly   625 --LKKKTARIKRFFGS------TMRKTVDK--AKSIASEVSHARHKEDVADIVDAMNPE----QN 675
              |.:.::.....||.      :.|..:.|  |||...::....|      ::::|:.|    |.
plant   131 GGLSESSSSKSGSFGDFHNSPFSQRDDLLKKGAKSWLKKLGVLTH------VLESMDCESVRTQL 189

  Fly   676 IKIKASSSNKGPY-EFTKLQHVQDLSGEDTSAVWCMKFSSCGRLLATAGQDKVLRIWVL-----K 734
            .::....::|..: |.:.:...|:.|..|.| :..||||..|:.:|:||:|.|:|:|.:     .
plant   190 HQVARVQTHKKQFKELSSMCIDQEFSAHDGS-ILAMKFSPDGKYIASAGEDCVVRVWSITEEERT 253

  Fly   735 DAYPFFQ-DMRNKYNADQKSSPTPSQESLVSQHSAEEAIAMATAAEKCTGPFMP--------KPF 790
            |.|...: |....:..:|:|...|.:   ::....|:..:....:...|...:|        ||.
plant   254 DTYEVAEVDSGVYFGMNQRSQIEPLK---INNEKTEKKSSFLRKSSDSTCVVLPPTIFSISEKPL 315

  Fly   791 CTYNGHTSDLLDVSWSKNYFILSSSMDKTVRLWHISRKECLCCFQHIDFVTAIAFHPRDDRYFLS 855
            ..:.||..::||:|||:..::||||:|:|||||.:...|||..|.|.:|||.:||:|.||.||:|
plant   316 HEFKGHIGEILDLSWSEKGYLLSSSVDETVRLWRVGCDECLRTFTHNNFVTCVAFNPVDDNYFIS 380

  Fly   856 GSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFCQNGQFAVVGSYDGRCIFYN--TDQLKYHT 918
            ||:|||:|:|::...:|..:.::   ..::||..:..:.:.||:||..|.|.||:  .:||:...
plant   381 GSIDGKVRIWDVTRCRVVDYTDI---RDIVTAVCYRPDAKGAVIGSMTGNCRFYHIFENQLQMDQ 442

  Fly   919 QIHVRSTRGKNRI-GRKISGIEPMPGE---DKILVTSNDSRVRLYDLRDLNLSCKYK-GYLNVSS 978
            :|:|   .||.:: .::|||::.:|.:   ||::|||.||::|:....|  :.||.| ..|..:|
plant   443 EINV---HGKKKVASKRISGLQYLPSDSDSDKVMVTSADSQIRIICGED--VICKLKASSLRTTS 502

  Fly   979 QIKGSFSHDGKYIIAGSENQCIYIWKTNHDYSKLSSVRRDRSD------FWEGIKAHNATVT--- 1034
               .||..|||:||:.||:..|.:|    .||:|.| ::..|:      .:||..:|||:|.   
plant   503 ---ASFISDGKHIISTSEDSYINVW----SYSQLPS-KKPYSETPKSIRSYEGFLSHNASVAIPW 559

  Fly  1035 -----------CA-----------IFAPHPEAIIKPEPD----EISNE---KLAHNQPDPLVEQH 1070
                       |.           .|:|...:...||..    .:||.   ||..:...|.:   
plant   560 LRQGRRDGLSECITDLDMKIPKVDCFSPMKGSTTWPEEKLEDVAMSNRGKLKLLRSAWQPHL--- 621

  Fly  1071 KKGCGYVLVSADFNGAIKVFINKTKP 1096
               .|.|:|:|.::|.|:||.|...|
plant   622 ---WGLVIVTATWDGRIRVFHNYGLP 644

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34133NP_001036772.2 WD40 repeat 663..700 CDD:293791 6/42 (14%)
WD40 704..1101 CDD:225201 141/453 (31%)
WD40 704..1046 CDD:295369 124/394 (31%)
WD40 repeat 707..765 CDD:293791 18/64 (28%)
WD40 repeat 800..834 CDD:293791 18/34 (53%)
WD40 repeat 841..878 CDD:293791 17/37 (46%)
WD40 repeat 885..920 CDD:293791 12/37 (32%)
WD40 repeat 935..975 CDD:293791 17/44 (39%)
WD40 repeat 978..1003 CDD:293791 11/25 (44%)
WD40 repeat 1034..1069 CDD:293791 10/67 (15%)
AT1G64610NP_176642.1 WD40 <206..550 CDD:225201 120/364 (33%)
WD40 212..525 CDD:295369 113/332 (34%)
WD40 repeat 222..260 CDD:293791 14/38 (37%)
WD40 repeat 265..305 CDD:293791 6/43 (14%)
WD40 repeat 326..360 CDD:293791 19/34 (56%)
WD40 repeat 365..399 CDD:293791 18/34 (53%)
WD40 repeat 408..445 CDD:293791 13/37 (35%)
WD40 repeat 457..494 CDD:293791 15/39 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 221 1.000 Inparanoid score I1170
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1332590at2759
OrthoInspector 1 1.000 T124306
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14221
Phylome 1 0.910 0.950 Consistency score
66.070

Return to query results.
Submit another query.