DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34133 and AT5G42010

Sequence 1:NP_001036772.2 Gene:CG34133 FlyBaseID:FBgn0083969 Length:1108 Species:Drosophila melanogaster
Sequence 2:NP_001318727.1 Gene:AT5G42010 AraportID:AT5G42010 Length:709 Species:Arabidopsis thaliana

Alignment Length:861 Identity:215/862 (25%)
Similarity:348/862 (40%) Gaps:239/862 (28%)


  Fly   313 DNEDTDSDTR-SVKSVQGLQQKLRDDFVMEFESSLNNATSSASNITLTCSSTNTVVSASASTSAA 376
            :.||..||.| .|.||.....::.||||        .||......|                   
plant     8 EEEDWFSDAREEVSSVSDCNSEVADDFV--------QATGDLDLWT------------------- 45

  Fly   377 SSSLPSTIAIHMRPMVASVTIAGPKLTQSLGSSSTSVHSKPSPSNSAKSNSAPARVSSIDPNQGL 441
                       |.|  .|||....|..||:|.|                      ....|.:..|
plant    46 -----------MNP--ESVTNRRQKFFQSMGFS----------------------FKKRDFDLDL 75

  Fly   442 NLFKAIQGGYVVKPRDEASNKAQGPSQDEIERIEKMLMESANRPKLAGTGSNSLGSSTRYPGF-Y 505
            :|.......::  |..:..........:|.|:.||:|   .|....:|:..:|..:::....| :
plant    76 DLLGDSSSDHI--PVSKQLTSVSETDHEEEEKEEKLL---RNESTSSGSSVSSFSTASLAEAFSF 135

  Fly   506 RGVNDKERRKSAGDEDVLKQMNIYVRTRTSSGKQLTDFEILEQVPVKNLDT-GE--NMPLSEMRS 567
            || :.:.|.|:..|:.:|        ||..|....:..|.|.:......|: |:  |.|:|....
plant   136 RG-SFQNRAKNIDDQILL--------TRDYSSNSSSIAEGLSESDSSRFDSYGDLPNSPMSRYEE 191

  Fly   568 PPV--PEGWNPLSLHILKLTSHLEVIQKESDEESVIGIPPSIEGQQPDEEELETEDGSRLKKKTA 630
            .|.  .:||    |..|.:.:|  |:.|..                      |..||...:    
plant   192 SPKKGAKGW----LKKLGVLTH--VLDKTE----------------------ECTDGESTR---- 224

  Fly   631 RIKRFFGSTMRKTVDKAKSIASEVSHARHKEDVADIVDAMNPEQNIKIKASSSNKGPYEFTKLQH 695
                   |::|:.:.:.:|...:..                                 |.:.|..
plant   225 -------SSIRRQLTRVQSFKKQFK---------------------------------ELSSLCV 249

  Fly   696 VQDLSGEDTSAVWCMKFSSCGRLLATAGQDKVLRIW-VLKDAYPFFQDMRNKYNADQKSSP---- 755
            .|:.|..|.|.| .||||..|:.||:||:|.|:|:| :::|     :...|::...:..|.    
plant   250 GQEFSAHDGSIV-VMKFSHDGKYLASAGEDCVVRVWNIIED-----ERRDNEFEVAESDSSCVYF 308

  Fly   756 ---TPSQ-ESLVSQH-SAEEAIAMATAAEKCTGPFMPK--------PFCTYNGHTSDLLDVSWSK 807
               ..|| |.|.::: ..|::..:.....:.|...:|.        |...:.|||.::||:|||:
plant   309 GMNDKSQIEPLKTENEKIEKSRGLLRKKSESTCAVLPSKVFSISETPQHEFRGHTGEILDLSWSE 373

  Fly   808 NYFILSSSMDKTVRLWHI-SRKECLCCFQHIDFVTAIAFHPRDDRYFLSGSLDGKLRLWNIPDKK 871
            ..|:||||:|:|||||.: |..||:..|.|..|||.:||:|.||.||:|||:|||:|:|::...:
plant   374 KGFLLSSSVDETVRLWRVGSSDECIRVFSHKSFVTCVAFNPVDDNYFISGSIDGKVRIWDVSQFR 438

  Fly   872 VALWNEVDGQTKLITAANFCQNGQFAVVGSYDGRCIFYNT--DQLKYHTQIHVRSTRGKNRI-GR 933
            |..:.::   .:::||..:..:|:.|||||..|.|.||:|  :||:....|   |..||.:: .:
plant   439 VVDYTDI---RQIVTALCYRPDGKGAVVGSMTGECRFYHTTDNQLQLDRDI---SLHGKKKVPNK 497

  Fly   934 KISGIEPMPGE-DKILVTSNDSRVRLYDLRDLNLSCKYKGYLNVSSQIK----GSFSHDGKYIIA 993
            :|:|.:..||: ||::|||.||::|:  :..::..||.|...::.:.:.    .||:.|||:|::
plant   498 RITGFQFFPGDSDKVMVTSADSQIRI--ICGVDTICKLKKASSLRTTLMSPTFASFTSDGKHIVS 560

  Fly   994 GSENQCIYIWKTNHDYSKLSSVRRDRSDFWEGIKAHNATVTCAIFAPHPE-AIIK---------P 1048
            ..|...|::|..:....|.||.:......:||..:.|.:|.........| :||.         |
plant   561 TIEESGIHVWDFSQPNKKASSQKPKTIRSYEGFLSRNVSVAIPWLGQGKEDSIIADLEKSFAHFP 625

  Fly  1049 EP-DEISNEKLAHNQPD---------------------------PLVEQHKKGC-----GYVLVS 1080
            .| |..|..|.|...|:                           ..|.|:..|.     |.|:|:
plant   626 VPLDYFSPMKGATTWPEEKLGVVAGTAAAAVSATVSSRSKLRLLKSVCQNVHGSTPHLWGLVIVT 690

  Fly  1081 ADFNGAIKVFINKTKP 1096
            |.::|:|:||.|...|
plant   691 ATWDGSIRVFHNYGLP 706

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34133NP_001036772.2 WD40 repeat 663..700 CDD:293791 3/37 (8%)
WD40 704..1101 CDD:225201 142/464 (31%)
WD40 704..1046 CDD:295369 121/370 (33%)
WD40 repeat 707..765 CDD:293791 21/67 (31%)
WD40 repeat 800..834 CDD:293791 19/35 (54%)
WD40 repeat 841..878 CDD:293791 17/37 (46%)
WD40 repeat 885..920 CDD:293791 15/37 (41%)
WD40 repeat 935..975 CDD:293791 15/41 (37%)
WD40 repeat 978..1003 CDD:293791 8/29 (28%)
WD40 repeat 1034..1069 CDD:293791 11/73 (15%)
AT5G42010NP_001318727.1 WD40 250..589 CDD:225201 118/353 (33%)
WD40 251..523 CDD:295369 103/284 (36%)
WD40 repeat 261..298 CDD:293791 16/43 (37%)
WD40 repeat 303..360 CDD:293791 9/57 (16%)
WD40 repeat 367..402 CDD:293791 20/35 (57%)
WD40 repeat 407..441 CDD:293791 18/34 (53%)
WD40 repeat 449..489 CDD:293791 17/43 (40%)
WD40 repeat 499..524 CDD:293791 12/27 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 221 1.000 Inparanoid score I1170
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1332590at2759
OrthoInspector 1 1.000 T124306
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14221
Phylome 1 0.910 0.950 Consistency score
66.070

Return to query results.
Submit another query.